(data stored in ACNUC30630 zone)

EMBL: CP001275.PE134

CP001275.PE134       Location/Qualifiers
FT   CDS_pept        complement(144776..145684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0137"
FT                   /product="sugar abc transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04696"
FT                   /db_xref="GOA:B9KXF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF0"
FT                   /protein_id="ACM04696.1"
FT                   /translation="MRTSEATTGPYPIVPAEVARPIRSTGRRLRHRLIWATMIIFALFC
FT                   IVPIYWILITALRPRGEIFESPALLYPQHITLDNLRYVWLGSQTNDPVLPFVFTSFLVA
FT                   TASACLTLFLSLPAAYALSRWRVGGNHLAMWILSQRFIPPIAVIVPLYLLYRRIGWLDT
FT                   YHGLILLYTVINIPITVWILRNYIDALPRDIEEAALVDGATPVQILRHIVLPLSWPSLG
FT                   AAAILAFLAIWNEYVFAYQLAGRNVAMVTVYFPRLRSAIGELYGEVAAAGLLALLPALL
FT                   VTGFLRRYIVRGLTLGGGREL"
     atgcgcacca gcgaagcaac gaccgggccg tatcccatcg tcccggctga agtagcccga        60
     ccgatccgct caacggggag gcggctccgt caccgactga tttgggcgac catgatcatc       120
     tttgccttat tctgcattgt accgatctac tggatactca tcactgcact tcgcccgcgg       180
     ggtgagatct ttgaatcacc agccctactc tacccacaac atattactct tgacaatctt       240
     cgctatgtct ggctcggatc gcaaacgaac gatccggtac ttcccttcgt cttcaccagc       300
     tttctcgtgg cgaccgcgag tgcatgcctg acgctgttcc tgtcgctgcc agcagcgtat       360
     gcactctccc gttggcgagt cggcggtaac cacctcgcca tgtggatact ctcccagcga       420
     ttcattccac ccatcgccgt tatcgttccc ttatatctgc tctaccgtcg tattggttgg       480
     ctggatacct atcatgggct gattctcctc tacacggtca tcaacattcc gattaccgtc       540
     tggattctcc gcaactacat cgatgctctc ccacgcgaca tcgaagaggc tgcgctcgtg       600
     gatggagcca cgcccgtaca gattctgcgg catatcgtcc tccccctgtc gtggccgagt       660
     ctcggggctg cagccattct ggcattcctg gcgatctgga acgagtacgt gttcgcttat       720
     cagctggccg gacggaatgt cgcgatggtg acggtctatt tcccgcgcct ccgctcagcg       780
     atcggagaac tctacgggga ggtcgcagcg gctggactgc tcgccttgct ccccgctctg       840
     ctggtcaccg gatttctccg tcggtacatc gttcgcggcc tgactctcgg cggtggaagg       900
     gagctctga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page