(data stored in ACNUC30630 zone)

EMBL: CP001275.PE142

CP001275.PE142       Location/Qualifiers
FT   CDS_pept        complement(155144..155443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0145"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05782"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF8"
FT                   /protein_id="ACM05782.1"
FT                   /translation="MSMRCPYCDFAGDRPTIHVHLAEAHADRLAFSWHERSGYAIATVR
FT                   CPLCGASWDQPLRKARRDPGFLDEYAYEIRLVLFDLLLHHIRGEHETEGEARDG"
     gtgagcatgc gctgtccgta ttgcgatttc gcgggtgacc ggccgacaat tcacgtgcac        60
     ctggcggagg cgcacgccga ccgactcgcc ttcagctggc acgagcgctc ggggtacgcc       120
     atcgcgacgg tacgctgtcc gctgtgcggt gcgagttggg atcaaccact gcgcaaggca       180
     cggcgcgatc caggcttcct cgacgagtac gcctacgaga ttcgcctggt gttgttcgac       240
     ctactcctcc accatatccg cggggaacat gaaacggaag gtgaggcgag agatggctga       300
//

If you have problems or comments...

PBIL Back to PBIL home page