(data stored in ACNUC30630 zone)

EMBL: CP001275.PE143

CP001275.PE143       Location/Qualifiers
FT   CDS_pept        complement(155440..155913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0146"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05249"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF9"
FT                   /protein_id="ACM05249.1"
FT                   /translation="MSAGCPDQLASAFAQRFRVLARALDRLDRLEGERAFVGWLDQLTE
FT                   QPHVLQDASEALVLQALRAASDPMNLALLRHLSVEEATGLAELAAELPLERIALHVRLG
FT                   ELAQAGLVALELEREAARLTALGNALRDWLDTLIRCTLDQVGAWLELVRSTQS"
     gtgagtgcag ggtgccctga ccagctggcc agtgcattcg cacagcgctt tcgtgtcctg        60
     gcgcgggcgc tggatcggct cgaccggctg gaaggggagc gtgccttcgt tggttggctg       120
     gatcagctca ccgaacaacc gcacgttctc caggatgcca gcgaagcact cgtgctccag       180
     gcactgcgtg cagcgagcga ccccatgaac ttggccctgc tgcgtcactt gtcggtcgag       240
     gaagccaccg ggctggcaga actcgctgcg gagctcccgc tcgagcggat cgcgctccac       300
     gtgcgcctgg gcgaactcgc gcaggcggga ctcgtggcgc tggagctgga gcgcgaagca       360
     gccaggctca cggcgctggg gaatgcactc cgggactggc tggacacact gatccgatgc       420
     actctggacc aggtcggcgc gtggttggaa ctggtacgga gcacgcagtc gtga             474
//

If you have problems or comments...

PBIL Back to PBIL home page