(data stored in ACNUC30630 zone)

EMBL: CP001275.PE147

CP001275.PE147       Location/Qualifiers
FT   CDS_pept        complement(159696..160997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0150"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05727"
FT                   /db_xref="GOA:B9KXG3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG3"
FT                   /protein_id="ACM05727.1"
FT                   /translation="MDPSLEKVQEVWERETAIVEGVDISGPWNRMFGQRVIWDYTPELI
FT                   EEIARLPSGESFAWCYQCGKCVPVCPVDVVGDYGPRKLYRRAQTGINLLDSPDLWLCTT
FT                   CANCLRVCPKQVDMIQIMPAAREHAMLSGRVIPSELQEALENTAKYGNPLGQPARKREA
FT                   WVKDAGVPVPILHQIQRPVEWLWWVECYPSYHPRGIDASIALARIFHALGLDFAILGRE
FT                   EKCAGDSQRLAGERGLFEMLAEENIRTLSKYEFQHIVVTDPHALNAFRKHYPKLGGQYD
FT                   VWHYTTLLARELSRLQPLLVRPLPYRVTFHDPCYLGRHNGEYDAPRQLIQAIPGIEFVE
FT                   MLRCRENSYCCGGGGGGMWLDSFAAGHQRRRLSEERVLEAVSTGADTLVVCCPYEVSRF
FT                   EDAVKSTGNEGRLRVRDIAELLAEAMGMIGEATA"
     atggatccga gcctggaaaa ggtgcaggaa gtctgggagc gagaaaccgc gatcgtcgaa        60
     ggggtcgata tttccggtcc ttggaaccgg atgttcggcc aacgcgtcat ctgggactat       120
     acccctgagc tgatcgaaga gatcgctcgc ttgcctagtg gggaatcgtt cgcctggtgc       180
     taccagtgcg gtaagtgcgt cccggtctgc ccggtcgacg tggtcggtga ttatgggcca       240
     cgcaagctgt accggcgggc acagaccggg atcaacctcc tcgattcgcc cgacctctgg       300
     ctctgcacca cgtgtgccaa ctgtctccga gtctgcccca agcaggtcga tatgatccag       360
     atcatgcccg cggcccgcga gcacgccatg ctgagtgggc gcgtcatccc cagcgaactc       420
     caggaggcgc tcgagaacac tgccaaatac ggaaacccgc tcgggcaacc ggcccgcaag       480
     cgcgaagcct gggtcaagga cgccggcgta cccgtgccga tcttgcacca gatccagcgt       540
     ccggtcgagt ggctgtggtg ggtcgagtgc tacccctcct accatccgcg cgggatcgac       600
     gcctcgatcg cgttggcccg catcttccac gcgctcggtc tcgatttcgc catcttgggt       660
     cgcgaggaga agtgtgccgg cgactcgcag cgactggctg gtgagcgcgg gctgttcgag       720
     atgctggccg aggagaacat ccgtaccctc tccaagtacg agtttcagca catcgtcgtg       780
     accgatccgc atgccctcaa tgccttccgc aagcactatc cgaagctcgg cggacaatac       840
     gacgtttggc actacacgac gctcctcgcc cgcgagctct cgcgcctgca gccgctcctc       900
     gttcgcccgc tgccctaccg cgtcaccttc cacgatccct gctacctcgg ccgtcacaac       960
     ggcgaatacg acgcaccacg gcagctgatc caggcgattc ccggcatcga gttcgtcgag      1020
     atgctgcgtt gtcgcgagaa ctcctactgc tgcggcggcg gtggaggtgg catgtggctg      1080
     gacagcttcg cggctggcca tcagcgccgg cgcctttctg aggagcgcgt gctcgaagcg      1140
     gtcagcaccg gtgccgacac cttagtcgtg tgctgcccgt acgaagtctc ccgcttcgag      1200
     gatgccgtga agtcgaccgg aaacgaggga cgcttgcgtg tccgcgatat cgctgagctt      1260
     ctggccgagg cgatggggat gatcggggag gcaacagcat ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page