(data stored in ACNUC30630 zone)

EMBL: CP001275.PE148

CP001275.PE148       Location/Qualifiers
FT   CDS_pept        complement(161010..161810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0151"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06263"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG4"
FT                   /protein_id="ACM06263.1"
FT                   /translation="MGQPLRPSHLIKPKTGPEDPELAETLREGLEQVSPDDVLAIAREL
FT                   AGRRQYLAPLVERIAREVERGELRGWEELTRAVTATARQAETLAQQAARAQACAALPLL
FT                   LREEQPVEQRLDEFLARCSDLDRRLALELATGVLHLRAPARYWLWTRWLWDIEHGTGIL
FT                   PLLASSTRALEGRSVGAQYRQLRPLVAMGTELGRNSGLVAHDLADDPELGPFVTDAFLA
FT                   LAYSVYLYGITNWRLSREFNRLLPPLPQLARRLLGLGRARAVRS"
     atgggtcaac cgctgcgtcc cagccatctc atcaagccca aaaccggccc ggaggacccg        60
     gaactggccg agacgctccg ggaagggctc gagcaagtat caccggacga tgtgctcgcg       120
     atcgcccggg aactggcagg gcgacggcag tatctcgcac cgctggtcga acggatcgcc       180
     cgcgaagtcg aacgaggcga gttacgcggg tgggaagagc tgacccgcgc tgtaaccgca       240
     acggctcgcc aggcggaaac actcgcgcag caggccgccc gcgcacaggc ctgcgctgcc       300
     ctcccgctgc tcctccgcga ggaacagccg gtcgagcagc ggctcgacga gttcctggcc       360
     cgttgcagcg acctggatcg gcgattggcg ttggagttgg ccactggcgt ccttcacctg       420
     cgagcaccgg cccgctactg gctgtggacc cgctggctgt gggacatcga gcacggcacc       480
     ggtatcctcc cgctcctcgc ttcctccacg cgagccctgg agggacgcag cgtcggcgct       540
     cagtaccgcc agttgcgccc gctcgtcgcg atgggcacgg aattgggccg caacagcggg       600
     ctggtggctc atgacctcgc ggacgatccg gaactcggtc ctttcgtcac cgacgccttt       660
     ctcgcgctgg cctacagcgt ctatctctat ggcatcacca attggcgcct gagtcgggag       720
     ttcaatcggc tcctgccgcc tctcccacaa ctcgcgcggc gcttgctggg tctcggccga       780
     gcacgcgctg tccgctcgtg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page