(data stored in ACNUC30630 zone)

EMBL: CP001275.PE150

CP001275.PE150       Location/Qualifiers
FT   CDS_pept        complement(162116..163183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0153"
FT                   /product="CoB--CoM heterodisulfide reductase iron-sulfur
FT                   subunit A 1"
FT                   /EC_number="1.8.98.1"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04541"
FT                   /db_xref="GOA:B9KXG6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG6"
FT                   /protein_id="ACM04541.1"
FT                   /translation="MQETTRPILVIGGGPGGLEAARTVAALGHPVLLVERRGRLGGTPD
FT                   AERYAKLTHHFRDAEEAIGELVAAVTDHPLIEVLTRSEVTACEGEAGDFRVTVSTPTGS
FT                   REARVSAIIVATGFQHFDPGRETQLYNYYSFPDVVTLSDMEAMLKAHQVVRPSNGQPPE
FT                   RVAFIQCVGSRDRQIGNEFCSKVCCGIASKQAIEIKEQLPDARVFIFYIDMRMYGYWEN
FT                   ELYWPAQERYKVNYVKGIVSEILPKGDRLLIRGEDTTMGRPMEITVDLVVLSVGMEPSS
FT                   GTRQMAKLLGIAQNKYGYIEAGGPSGLDPVATSRPGIYVVGAAARPADLDDTFATAGLA
FT                   AARAVATARQALVGT"
     gtgcaggaga cgacccgtcc cattctggtc atcggtggcg gccccggtgg gctcgaggcc        60
     gcccgcaccg ttgcagcgct cggtcatcca gtgctcctcg tcgagcgccg aggtcgactg       120
     ggtggcacac cggatgccga acggtatgcc aagctgacgc accactttcg cgatgccgaa       180
     gaggcgatcg gcgagctcgt cgccgcggtc accgatcacc ccctcatcga agtgctgacc       240
     cggagcgagg tcaccgcctg cgagggggag gcaggcgatt tccgagtgac ggtgagcacg       300
     cccactggca gccgagaggc tcgagtcagc gcgatcatcg tcgccaccgg cttccaacac       360
     ttcgatccgg ggcgcgagac gcaactgtac aactactact cgttccctga tgtcgtgacc       420
     ttgagcgaca tggaggcgat gctcaaggcc caccaggtcg tccgcccctc caatgggcaa       480
     cccccggaac gagtggcctt catccagtgc gtcggatccc gcgaccggca gatcgggaac       540
     gagttttgct ccaaagtctg ctgcggtatc gcctccaagc aagcgatcga gatcaaggaa       600
     cagctgcccg acgcccgtgt cttcatcttc tacatcgaca tgcgcatgta cggctactgg       660
     gagaacgagc tgtactggcc ggctcaggaa cgctacaagg tcaactacgt caaagggatc       720
     gtcagcgaga tcctgcccaa gggggatcgc ttgctgatcc gcggggagga cacaacgatg       780
     ggtcgaccga tggagatcac ggtcgacctg gtcgtcctct ccgtcggtat ggagccgagc       840
     agcgggacgc ggcagatggc caagttgctg ggcatcgccc agaacaagta cggctacatc       900
     gaggccggcg gaccctccgg tctcgacccg gtcgcgactt cccgaccagg aatctacgtc       960
     gtcggtgctg cggcccgacc agctgacctg gacgatacct tcgctactgc cggtctcgct      1020
     gcggcacgag cggtcgcgac ggcgcgccaa gccttggtcg gaacgtga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page