(data stored in ACNUC30630 zone)

EMBL: CP001275.PE151

CP001275.PE151       Location/Qualifiers
FT   CDS_pept        complement(163194..164411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0154"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04989"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG7"
FT                   /protein_id="ACM04989.1"
FT                   /translation="MSEYMLPLVEIREKKAQPVRPNPAEAPRPDLREELFELEARGELI
FT                   VQRVPEPYVEVTTKYGRTKKVPIDHLWHHKSCGQCGHIPGYTTSILWLNRQFGIDYLDP
FT                   TDQTSCTGWNYYASATSNAVAQLLVMCRNFAAAYETGYYPLIHCGTSYGHYKELREQLV
FT                   HHKELRDQVRRVLDKLGKPLVVPEEIVHYSEWVHVMRQRIAERQVIDMRGITACVHPAC
FT                   HYYKIVAEDAIYDPDIYGGQRTATVTALLQALGITVADYSTWFDCCGFGFRHILVQRDF
FT                   TRSFAVLRKIEVMKDEANPDMTVTHDTGCVTTLDKSQFAARAHQRRVGVPVLADSQVAA
FT                   LAMGAHPFRVLQLHWHSTDWRPLLEKLGIDWERYWTEFEEDLAAIERGEKPGLTWQDAE
FT                   QPIVTR"
     atgagcgagt acatgcttcc gctcgtcgag attcgcgaga agaaggctca accagtccgt        60
     cccaatccgg ccgaagcgcc ccgaccggat ctccgcgagg agttgttcga gctggaggct       120
     cgcggggagc tgatcgtgca gcgggttccc gaaccgtatg tcgaggtgac gaccaagtac       180
     ggacgcacga agaaggtgcc gatcgatcat ttgtggcacc acaagtcgtg tggtcagtgc       240
     ggtcatattc caggctacac gacctccatt ctgtggctga accgacagtt cgggatcgac       300
     tacctcgatc ccaccgacca gacctcctgc accggctgga attactacgc ctcagcgact       360
     tccaatgcgg tcgcccagct cctggtgatg tgccggaact tcgcggccgc ctacgagacc       420
     ggctattacc cgctgatcca ctgcggcacg agttatggcc attacaagga actccgcgaa       480
     cagttggtgc atcacaagga actgcgcgat caagtccgtc gcgtactcga caaactcggt       540
     aaacccctcg tcgttcccga ggagatcgtg cactacagcg agtgggtgca cgtgatgcgc       600
     cagcggattg cggagcggca agtcatcgac atgcgcggta tcaccgcctg tgtccatcct       660
     gcatgccact actacaagat cgtggcggaa gacgctatct acgacccgga tatctacggt       720
     gggcagcgaa cggcgacggt gacggcgctg ctccaggcac tgggcatcac ggtcgctgat       780
     tactccacgt ggttcgactg ctgcggcttc ggtttccgtc acatcctcgt ccagcgcgac       840
     ttcactcgtt ccttcgccgt tctgcgcaag atcgaggtga tgaaagacga agccaatcca       900
     gacatgacgg tgacgcacga cacggggtgc gtcacgacgc tggacaagag ccagttcgcc       960
     gcgcgagccc accagcggcg cgtcggtgtc ccggtcttag ccgattcgca agtggccgcc      1020
     ctcgccatgg gggcgcatcc gttccgcgtg ctccagttgc attggcattc gactgactgg      1080
     cgaccgctgc tcgagaagct cggtatcgac tgggagcgct actggaccga gttcgaagag      1140
     gacttggctg cgatcgagcg cggtgagaag ccgggtctga cctggcaaga cgctgaacag      1200
     ccgatcgtga cgcggtga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page