(data stored in ACNUC30630 zone)

EMBL: CP001275.PE156

CP001275.PE156       Location/Qualifiers
FT   CDS_pept        complement(166262..166783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0159"
FT                   /product="hypothetical conserved protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05824"
FT                   /db_xref="GOA:B9KXH2"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXH2"
FT                   /protein_id="ACM05824.1"
FT                   /translation="MSRRDPEAPRRLAIIASKGTLDFAYPPFILGSTAAAMGWEVAIFF
FT                   TFYGLPLLLRNYDPKVSPLGNPAMPLKMPFGPPALRQISWPIPALVEALPGFSHLATTL
FT                   MQQTFKEKGVPSLLELRQLCIDAGVNLIACQMTMDVFGFKKEDFIPECTVGGAATFLEF
FT                   AADADVSLFI"
     atgtcccgtc gcgatccgga agcgccccgg cgactcgcga tcatcgcgag caaaggaacg        60
     ctcgattttg cctatccgcc cttcatcctc ggttccacgg cagcggcgat gggttgggaa       120
     gtcgcgatct tctttacctt ctacggcctt cccttgctgc tgagaaatta cgatcccaaa       180
     gtcagtccgc tcggcaatcc tgccatgccg ctcaagatgc cgttcggtcc accagcactc       240
     cgccagatct cctggccgat ccccgcgctc gtcgaggcac tacccggctt ctcacacctc       300
     gcgacgactt tgatgcagca gaccttcaag gaaaaggggg ttccctcctt gctcgagctg       360
     cggcaactgt gcatcgatgc gggcgtcaat ctcatcgcgt gccagatgac gatggacgtc       420
     ttcggcttca agaaggagga cttcatcccc gagtgcacgg tcggtggtgc cgcgaccttc       480
     ttagagttcg cagctgatgc ggatgtctcg ctcttcatct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page