(data stored in ACNUC30630 zone)

EMBL: CP001275.PE172

CP001275.PE172       Location/Qualifiers
FT   CDS_pept        182192..182920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0175"
FT                   /product="putative glycoprotease family"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06082"
FT                   /db_xref="GOA:B9KXI8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI8"
FT                   /protein_id="ACM06082.1"
FT                   /translation="MERSDQLLLALDSGGEQVAIALYDGRVVGELLYDAGREHTATVLP
FT                   RIRQLLAENRRTIRDVAAVAVTTGPGSFNGLRVGMSIAKALCYALDVPLIGVLTLDALA
FT                   YPHTALPYPIRAFVAAGRGRVVYADYRRQGEIWVRDSSLRSVRLHEVTDGLLGRTVLTG
FT                   HLAPEEEALVRSHPLVILPAPALRQLRPAWVAELAFRRWQAGESDPVAALEPIYVHGGG
FT                   AEAIPSVQLPMSYDVRPARE"
     gtggagcgaa gcgatcaact gctcctggca ctcgatagcg gcggggagca ggtagcgatc        60
     gcgctgtacg acgggcgcgt cgtcggagaa ctcctctacg acgccgggcg cgagcatacc       120
     gcgactgttt tgccacgcat tcgtcagttg ctcgccgaga atcggcgaac tatccgtgat       180
     gtcgcagcgg tcgccgtcac caccggaccg gggagcttca atggtctacg ggtggggatg       240
     agtatcgcca aggcgctctg ttatgcgctg gacgtaccgc tcatcggcgt cttgacgctc       300
     gatgcgctgg cgtaccctca taccgcctta ccttacccga tccgtgcgtt cgtcgcagcg       360
     gggcgtggtc gcgtggtcta cgccgattac cggcggcagg gcgagatctg ggtacgggac       420
     tcgtctttgc gctcggtgcg tctccacgag gtgacggatg gattgttggg acgcaccgtg       480
     ctgacggggc atctcgcgcc cgaggaagag gcgctggtac ggtctcatcc gctcgtcatt       540
     cttcctgctc cagcgttgcg ccagcttcgt cctgcctggg tggccgaact ggctttccga       600
     cgctggcagg caggcgagag cgatccggtg gctgcgctgg agccgatcta tgtccacggg       660
     ggcggggcag aggccattcc ttcggtacaa ttgccgatga gttacgatgt ccgacccgcg       720
     cgggagtga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page