(data stored in ACNUC30630 zone)

EMBL: CP001275.PE175

CP001275.PE175       Location/Qualifiers
FT   CDS_pept        184706..185503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0178"
FT                   /product="inositol-1-monophosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="identified by match to protein family HMM PF00459"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05295"
FT                   /db_xref="GOA:B9KXJ1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXJ1"
FT                   /protein_id="ACM05295.1"
FT                   /translation="MRTMATVRQVAVAAALSAGRLLRERLGRVREIRYKGAVNLVTEVD
FT                   IASERLIVETIQAAFPEHAFFTEEGTGSASLDAPALWVIDPLDGTTNYAHGYPMFCVSI
FT                   AFLCEGEPEFAVVYQPVLDELFIAERGVGAFLNGERLRVSQHADLHSALLATGFPYDRE
FT                   RRREALAAFARFTLTARAVRRDGSAALNLAYVAAGRFDGFWEQELSPWDTAAGTLLVTE
FT                   AGGRVTDYDGQPYRLTQGTCVASNGLIHDAMLDLIRRDDRGGA"
     atgaggacga tggcgacggt gcggcaggtg gcagtggcgg cagcactctc cgctggccgg        60
     ttgttgcgcg aacggctcgg gcgggtccgc gagatccgct acaagggagc ggtcaacctg       120
     gtgaccgaag tggatatcgc cagcgaacga ctgatcgtgg aaacgatcca ggcagccttc       180
     cccgagcacg cgttcttcac cgaggaagga acgggcagtg cgtcgctgga tgcgcccgcg       240
     ctctgggtca tcgatcccct tgatgggacg accaactatg ctcacgggta cccgatgttt       300
     tgtgtctcga tcgcgtttct ctgcgaggga gagccggagt ttgcggtcgt gtaccagcca       360
     gttctggacg agctgttcat cgctgagcga ggggtgggag catttttgaa cggggagcgg       420
     ctccgcgttt cccagcatgc ggatctgcat agcgcgctct tggcgactgg tttcccgtac       480
     gatcgcgagc gacgacgcga ggccctcgct gctttcgcac gcttcacgct gacggctcgg       540
     gcagtgcggc gagacgggag cgcagctttg aacctcgcct acgttgctgc tggccgtttc       600
     gatggttttt gggagcagga actttccccg tgggatacag cagcgggaac gctcctggtc       660
     accgaagctg gcgggcgcgt gactgattac gatgggcaac cgtatcgact gacccagggc       720
     acctgtgtcg cgtcgaacgg gctcatccac gacgcgatgt tggacctgat ccgtcgcgac       780
     gatcgaggtg gtgcgtga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page