(data stored in ACNUC30630 zone)

EMBL: CP001275.PE187

CP001275.PE187       Location/Qualifiers
FT   CDS_pept        complement(194995..196659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0190"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06388"
FT                   /db_xref="GOA:B9KXK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK3"
FT                   /protein_id="ACM06388.1"
FT                   /translation="MIEVEALRYRYPTSRYPALVAPHWAVEAGEFVLLAGETGSGKTTL
FT                   LRSLVSLVPHFYGGWFGGRVLVGGRDTRHHRPADLAGLVGYVGQEPETQTLLDRVWDEI
FT                   AFALENLGFPPRVVAARVEEALDLLGLAHLRNRPIETLSGGERQRLTLASVLALRPQLL
FT                   LLDEPTSQLDPWSAETVLEVLRRLVDELGITLVIAEHRLDRLLGSCTRLTLLEDGKIVA
FT                   DGSPQHVAERLPDPPILVQVSRLLGWSPPALSVAEGKRRLRGCQLLSPVQRPAPSPGPT
FT                   PLALERIACRRGERLVLEDVTLEVARGLVTGIVGRNGSGKTTLLRAALGLEGIVRGRVW
FT                   LGGRPVHETLRAGESGSIAYVPQYPGALLVGSRLRDDLELVARVRQVSTTAVDEIVDLF
FT                   ELHPLLDTHPADLSSGERQRAALAVALTGHPALIVLDEPTRGLGLRLKQRLASELRRRA
FT                   AAGAAVLLTTHDVDFAAMVADRIVLLSEGRIVNEGPPHLVLGESFSYAPIVSRLFGPSF
FT                   VTVSDVEQALRENPAPAKHARIGYTEGDYGEFDRERA"
     atgatcgaag tggaggcact ccgctaccgc taccccacga gccggtatcc agcactggtc        60
     gccccgcact gggcagtgga agctggtgag ttcgtgctct tggccggcga gaccggttcg       120
     gggaaaacga ccttgctgcg cagtctcgtc agcctggttc cccacttcta tggtgggtgg       180
     ttcggcgggc gtgtcctcgt cggcggacgc gacacgcgcc accatcgccc agccgatttg       240
     gctgggctgg tcggctacgt tggtcaagag cccgagacgc agacgcttct ggatcgcgtc       300
     tgggacgaga tcgccttcgc gctggagaac ctcggtttcc caccgcgcgt cgtcgctgcc       360
     cgcgtcgagg aagcactcga tctcctcggg ctcgctcatc tccgcaatcg cccgatcgag       420
     acactttccg gcggtgaacg acagcgactc acactcgcca gtgttctcgc gctgcggccg       480
     caattgctcc tcctcgacga gccgacctcg cagctcgacc cgtggagcgc cgagaccgtc       540
     ctcgaggtct tgcgccgtct cgtcgacgag ctggggatca cgctcgtcat cgccgaacac       600
     cggttagacc gcctgctcgg gagctgtacg cgactcacgt tactggagga tgggaaaatc       660
     gttgcggacg gctcgcccca gcacgttgcc gaacgcttgc ccgatccacc gatcctcgtc       720
     caggtcagtc gtctcctcgg ctggtcgcca ccggccctct ccgtcgccga aggcaaacgg       780
     cggttgcgtg gatgccagct gctctcccct gttcagcgcc cagcgccgtc acccggcccg       840
     acgcctctcg ccctggagcg catcgcgtgc cgccgcggtg agcgtctggt gctggaggat       900
     gtgacgctgg aggtcgcgcg cgggctggtg acgggtatcg tcggacgcaa tggatcaggc       960
     aagacgacgc tcctgcgcgc ggctctcggc ttggaaggga tcgtacgcgg tcgggtctgg      1020
     ctcggtggcc gtccggtaca tgaaacgttg cgggcaggcg agtctggctc gatcgcctac      1080
     gtcccgcagt atcccggcgc actcttggtc gggagccgcc tccgcgacga cctcgaactc      1140
     gtcgcgcgcg tacgccaggt cagcacgact gcggtcgacg agatcgtcga cctcttcgaa      1200
     cttcacccgc tgctggatac ccatcccgct gacctgagca gcggtgaacg ccagcgtgcc      1260
     gctctcgccg tcgcgctcac cggtcacccg gcactcatcg tgctcgacga gccgacgcgc      1320
     gggttagggt tgcgactcaa gcagcgtctc gccagcgagc tgcgccggcg tgctgctgcg      1380
     ggggctgctg tcctcctcac cacgcacgac gtcgacttcg ccgcgatggt cgctgatcga      1440
     atcgttctcc tgagcgaagg acgcatcgtg aacgaagggc caccgcacct tgtcctgggg      1500
     gagagcttct cctatgctcc gatcgtcagc cgtcttttcg gtcctagctt cgtcacggtg      1560
     agcgacgtcg agcaggcgct ccgggaaaat ccagcgccag cgaaacacgc tcgaatcggt      1620
     tatactgagg gggactacgg cgagttcgat cgggaacgag cgtga                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page