(data stored in ACNUC30630 zone)

EMBL: CP001275.PE188

CP001275.PE188       Location/Qualifiers
FT   CDS_pept        complement(196656..197651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0191"
FT                   /product="putative Cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05603"
FT                   /db_xref="GOA:B9KXK4"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK4"
FT                   /protein_id="ACM05603.1"
FT                   /translation="MNAITWLLWALVLVLAISVTRNPFYLSLAALAVATVWIAVDTARP
FT                   LGRQAPRLPLLAAGFLLPWSTAVNALLAHIGDRVLFRLPAWPVIGGPITLNAALYGLLT
FT                   GIALTTALAGTTLLHAVIDRHQALRAIPPNQRVLATTLAIALNALPAFATAARDAVEAS
FT                   RLRGLALPRWRQLQIVVAAILYRGIDYSLATAEVLETRSFAARHRARPATQASSLAMLL
FT                   ASFAVIGGSLAGKPSLALVGVAGLSLGSALIVHSTWRNLRTLQWSLATGAAASLLLAAS
FT                   TLLVLSLRDSAADLAYSPYPALRWPGFSPLAGFAFLLLASPALFLRGSAR"
     atgaacgcga tcacctggtt gctctgggca ctcgtgctgg tgctcgcgat ctccgtgacg        60
     cgcaatccgt tctacttgag cctggcagcg ctggccgttg cgaccgtctg gatcgcagtc       120
     gatacggcgc ggccgctcgg ccggcaggcg cctcgcttac cgctcctggc tgctggcttt       180
     ctcctaccgt ggagcaccgc cgtcaatgcg ctgcttgccc acatcggcga ccgcgtcctc       240
     ttccgacttc ccgcctggcc ggtcatcggc ggacccatca cgctcaatgc agcactctac       300
     ggcttgctca ccggcatcgc actgaccacg gcactcgccg gaacgactct ccttcacgcc       360
     gtcatcgatc gtcaccaggc tctgcgcgcg attcctccca atcagcgtgt gctcgcgacc       420
     actctcgcga ttgccctgaa cgcgctccct gctttcgcga cagcagcacg cgatgcggtc       480
     gaagcgtcgc gcctgcgcgg cctggcactg ccacgctgga ggcagcttca gatcgtcgta       540
     gcagcgatcc tctatcgtgg tatcgactac agtctcgcca cagctgaggt actggagacg       600
     cggagcttcg ctgcgcggca ccgggcgaga cccgctacgc aagccagttc gctcgcgatg       660
     ctcctcgcta gcttcgccgt catcggaggc agcctggctg ggaaaccgag cctcgctctg       720
     gtcggcgttg ccgggctgtc cctcggttcg gcgctgatcg tccactcgac ctggcgcaat       780
     ctccgcactc tgcagtggtc actcgcgacc ggagcggcgg cgtcgctctt gctcgcagcc       840
     tcgaccctcc tcgtcctgtc gctccgcgac tccgctgccg acctggcgta ctcgccttat       900
     ccggctttgc gctggccggg tttctctccg ctcgccgggt tcgcctttct cctgctcgcc       960
     tcaccggcac tctttctgcg aggatccgcg cgatga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page