(data stored in ACNUC30630 zone)

EMBL: CP001275.PE195

CP001275.PE195       Location/Qualifiers
FT   CDS_pept        204586..205449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0199"
FT                   /product="putative NAD(+) kinase"
FT                   /note="identified by match to protein family HMM PF01513"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06363"
FT                   /db_xref="GOA:B9KXL1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXL1"
FT                   /protein_id="ACM06363.1"
FT                   /translation="MARRFGVVAAHGKPEAVELADRIQRWLAAHQCQIANEEALPVVWP
FT                   ELDAIIAIGGDGLIMRVAHHYPDVPILGINVGRVGFLALAEREGWERALHDLVHDRYHV
FT                   QEGPTLAVQLERGRSVLVDAWAINDVVVRAGYQLIEVELYIDGQFVNTYPGDGMIVATP
FT                   QGSTAYCMAAGGPVLTAGVHGFAVTPICPHSPIRIALVVPEQATIEQVYVSDREARLII
FT                   DGEPVASLERGDLVRVRRGKQAFRLVVLPGTNFYEAFRSKFNFQIRPEAQPSRRTRNAD
FT                   TPSGAR"
     atggcacgac ggttcggcgt cgtcgcggcg cacggcaagc ctgaggcagt cgagttggct        60
     gaccggatcc agcgctggct cgccgcgcac cagtgccaga tcgctaacga agaagctctc       120
     ccggtcgtct ggccagaact cgacgcgatc atcgccatcg gcggtgacgg gctcatcatg       180
     cgcgtggcgc accattatcc tgatgttccg attctcggga tcaatgtcgg ccgggtcggc       240
     tttctggcct tggcggaacg cgagggatgg gaacgggcgt tgcacgacct ggtgcacgat       300
     cggtaccacg tccaagaggg tccaacgctg gctgtccagc tggaacgcgg gcgaagcgtg       360
     ctcgtcgatg cttgggcgat caacgatgtc gtggttcgtg ccgggtacca gctcatcgaa       420
     gtcgagctct acatcgatgg tcagttcgtc aacacctatc cgggtgatgg catgatcgtc       480
     gcgaccccac agggaagtac ggcttactgt atggctgcgg gtgggccggt gttgactgcc       540
     ggggtgcatg ggttcgccgt gacgccgatc tgtccgcact cgccgatccg cattgcgctg       600
     gtcgtcccgg agcaggcgac gatcgagcag gtgtacgtga gcgaccggga agcgcgcctg       660
     atcatcgacg gagagccggt cgcgtctttg gagcggggtg atctcgttcg ggtgcgacgg       720
     ggcaagcaag cgttccgtct cgtggttctg ccgggtacga acttttacga ggcattccgc       780
     agcaagttca atttccaaat ccgaccggag gcacagccca gccggcgaac ccgaaatgcc       840
     gacacgccat caggcgcgcg gtaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page