(data stored in ACNUC30630 zone)

EMBL: CP001275.PE197

CP001275.PE197       Location/Qualifiers
FT   CDS_pept        complement(206078..206422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0200"
FT                   /product="Protein of unknown function (DUF970) superfamily"
FT                   /note="identified by match to protein family HMM PF06153"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04557"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXL3"
FT                   /protein_id="ACM04557.1"
FT                   /translation="MTAPSKLVIAVVQARDADRLLDALQHEGFRATRISSTGGFLREQN
FT                   VTLLMGVEAHRIGEVLRLIKAHCYTRTQYVNPLFPIVESGEFFVPQPIEVEVGGANVFV
FT                   VPIERFERLP"
     atgacggccc cctcgaagct cgtgatcgcc gtcgtccagg cacgcgatgc cgacaggctg        60
     ctcgatgcgc tccagcacga gggattccgc gcgacccgga ttagcagtac gggagggttc       120
     ctgcgcgagc agaacgtcac gctgctgatg ggcgtcgaag cccaccggat cggggaggtc       180
     ttgcgcctga tcaaggccca ttgctacacg cgcacccagt acgtcaaccc cttgttcccg       240
     atcgtggaat cgggcgagtt cttcgttccg cagccgatcg aggtcgaggt cggcggcgcc       300
     aacgtcttcg tcgttccgat cgagcgtttc gagcgcctgc cctga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page