(data stored in ACNUC30630 zone)

EMBL: CP001275.PE202

CP001275.PE202       Location/Qualifiers
FT   CDS_pept        complement(210497..212734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0205"
FT                   /product="DNA translocase ftsK"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05215"
FT                   /db_xref="GOA:B9KXL8"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXL8"
FT                   /protein_id="ACM05215.1"
FT                   /translation="MARKRAKERRTRGETAPLAAGSQRRRLRAIVTRLAQVAALVPRRL
FT                   PRDLAGLFLATVGVLLTLALFGHERETGLAGWFAQTCRQLFGRGAIVVPLACWWGALEL
FT                   VASRSRAGTVRRAVGLALYGSAAVALLDARPADQVEEAGGYIGAGVAALLRLIGGDLGL
FT                   GLLALALGLAGSTLVAGIELGTLARTILTAARRTGQIVRRRSSARAVDLPASPAPAESG
FT                   RSDETVQRETTRPVIATRHTPASRSRGRRTPVSPQQRVQERPSGEPEPVAANAATPAAA
FT                   GDQVLPEISRLQRYEASLPDAEELERKAAIIQETLANFRVDARVREIYPGPAVTLFTLE
FT                   PGPGVKVRRITELQNDLALALAAPAIRIEAPVPGMARVGIEVPNSAISTVGLREVLESA
FT                   TFQRSRARLPLALGRDVHGEYVVADLTRMPHLLIAGATGSGKSVCINGIIATFLLTRRP
FT                   DELQMLLIDPKKVELAGYDGVPHLKRPVVTDMGLVVGALRRVLQEMERRYELFAQLGVR
FT                   NLEGYRLRREEDPSLEPLPYLVVIIDELADLMLTTPDEVETLLVRLAQMARATGIHLLI
FT                   ATQRPSVDVLTGLIKANVPARIAFAVTSQTDSRVILDMPGAERLLGRGDMLYLPPDAAR
FT                   PLRVQGSFIDDRDLEYVVEHWRQLYPVPQYDPSWLDLEETIQETSRGEDPLLEQARQLV
FT                   RQLGTASTSLLQRRLRIGYNRAARLMEQLEAEGIVGPAEGARGRVVYLGDE"
     atggcgcgga agcgagcaaa agaacggaga accagagggg agacagcacc gctcgccgcc        60
     ggttcccaaa gacgccgcct gcgcgcgatc gtcacccggc tggcacaggt ggcagcactc       120
     gttccgcgcc gcctgccgcg tgacctcgct gggctgtttc tcgccacggt cggcgtgctc       180
     ctgaccctgg cgcttttcgg ccacgagcgc gagactgggc ttgccggctg gttcgcccag       240
     acctgccggc aactcttcgg ccgcggtgcg atcgtggtgc cgctcgcctg ctggtggggt       300
     gccctcgaac tcgttgcctc ccgctcgcga gccggcacgg tccgccgggc cgtggggctc       360
     gcactgtatg gttccgcagc cgtcgccctg ctcgacgctc gcccggctga ccaggtcgag       420
     gaggctggag gttacatcgg tgccggcgtg gcagcactcc tccggctcat cgggggtgac       480
     ctcggtcttg ggctcctcgc tctggccctc ggcctggccg gctcgacgct cgtcgctggt       540
     atcgagctcg gcacgctcgc gcgaacgatc ctcacggcgg cgcgacgaac cgggcagatc       600
     gtccggcgga gatcgtccgc tcgcgcggtc gacctccccg cgtctccagc gccagcggag       660
     tccggccgct cggacgagac cgtccagcgc gaaacgacgc gaccggtcat cgcgacacgc       720
     cacacaccag cgagccgttc gcgtgggcgc cgaacgcccg tttcccctca gcagcgtgtc       780
     caagagcgcc cgtccggtga gccggaaccg gtcgcagcga acgcggccac gccggctgct       840
     gcaggggatc aggtgcttcc cgagatcagc cgcttgcagc ggtacgaggc gagcttgccc       900
     gatgcggaag aactggagcg caaggccgcg atcatccagg agacgctggc aaacttccga       960
     gtagacgctc gtgtccgcga aatctatccc ggtcctgccg tgacgttgtt caccctggaa      1020
     cccggtcccg gcgtcaaggt gcggcgcatc accgagcttc agaacgatct ggcattagcg      1080
     ctggctgcgc cagcgatccg gatcgaggca ccggttcccg gtatggcacg cgtgggcatc      1140
     gaggtcccga atagcgcgat ttccacggta ggcctgcgtg aggtactgga atcggcgacc      1200
     ttccagcgct ctcgagcacg cctcccgctg gctctcgggc gggacgtgca cggcgagtat      1260
     gtcgtcgctg acctgactcg catgccgcat ctcctcatcg ctggcgcgac cggatccggc      1320
     aaatcggtgt gcatcaacgg catcatcgcc acctttctgc tcacgcgccg gccggacgaa      1380
     ctccagatgc tgttgatcga tccgaagaag gtcgaactcg ctggttacga tggagtgccg      1440
     cacctcaagc gcccagtcgt gaccgatatg ggactcgtcg tcggtgcgct gcgacgcgtc      1500
     ctgcaggaaa tggagcgacg ctacgagctt ttcgcccaac tgggagtgcg caatctcgaa      1560
     ggttatcgcc tgcgacgcga ggaagaccca tcgctcgagc ccttgcccta tctcgtcgtc      1620
     atcatcgatg agctggctga tctcatgctg acgacaccgg acgaggtcga gacactcctg      1680
     gtgcgactgg cccagatggc tcgtgccact gggattcacc tcctgatcgc gacacagcgg      1740
     ccctcagtcg acgtcctcac cgggctgatc aaggccaatg tgccggcgcg gatcgccttc      1800
     gctgtcacct cgcagaccga tagccgggtg atcctcgata tgcccggggc cgaacgcttg      1860
     ctcgggcgcg gcgacatgct ctatcttccg cccgacgcgg cacgtccctt gcgcgtacaa      1920
     ggttcgttca tcgacgaccg cgacttggaa tacgtcgtcg agcactggcg gcaactctat      1980
     ccggtcccac aatacgaccc gagttggctc gatctcgagg aaacgattca ggagacgagt      2040
     cgaggcgagg accccttgct cgaacaggcc cgccaactcg ttcgccaact cgggacagcc      2100
     tcgacgtcgc tcctccagcg acgactgcgg atcggctaca accgggcagc acgcctgatg      2160
     gagcaattgg aagctgaagg aatagtcggc ccggctgagg gagcgcgcgg ccgcgttgtc      2220
     tatctcggtg acgagtga                                                    2238
//

If you have problems or comments...

PBIL Back to PBIL home page