(data stored in ACNUC30630 zone)

EMBL: CP001275.PE204

CP001275.PE204       Location/Qualifiers
FT   CDS_pept        complement(213313..215394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0207"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM PF01541; match to protein
FT                   family HMM PF02151; match to protein family HMM TIGR00573"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05471"
FT                   /db_xref="GOA:B9KXM0"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXM0"
FT                   /protein_id="ACM05471.1"
FT                   /translation="MSDQPVEPAYDRLRSRARQLLLARGGIASEEQLIEGLFGSLGNRR
FT                   LWAPFLAQLLETDAEIVRRPDGTWALRRRPLVPSRGWPRSFVALDVETTGLRPARHRII
FT                   EIGAVRYEDGCCVERFSVLVNPHRRLPVYIVRLTGIRDEDLLTAPSFVDVAAAFRVFLG
FT                   ESTVIGYNVGFDLDFLNAELRRIGQGPLPNPALDVLPLARALLTANGRYDLDAICRSIG
FT                   LARGTRHRALPDAEATAVLYLHLVERAEQVGYRSPSDLQPAATRRTIVVEPVARGRAVL
FT                   DQRLLADTPELPGVYLMRDALGRVLYVGKARNLRQRVRSYFSQPLGYTRKMDGLLESVA
FT                   EIETVVTGSELEALLLESQFVQRYKPPYNTQLRNHEAYPYVKVELGRPWPRLMLARQRD
FT                   DDDAVYVGPFRSTAAARSVVELLHQLLPLRTCHRSFRDARSYGRPCLQLTLGRCIGPCT
FT                   GCVTPDEYRALVDCALRYLSGETSVVVERAQQLLADAVERLDFERAARLRDLLRRSEEL
FT                   VFSHRLVRQTISGRPCVIVTPCPETGDRAFLLIVAGRLWARVVADPREHDAAVAARLGA
FT                   AWERAQQAAPWTLDQDSLDAAVIIARWLSEHAEDPTVFFLEHPVDWLALVRNGRSLPAS
FT                   AFAVHAPVDDENGTTKRTRGADSERGTQCEGTPGKHRRARPSLHALRSMADPHSGGAR"
     atgagcgacc agcccgtgga gccagcctac gatcgtctcc gcagtcgagc tcggcagctc        60
     ttgttggcgc gaggagggat cgccagcgaa gagcagctga tcgaggggct ctttggctcg       120
     ctcggcaacc gccggctgtg ggcaccattc ctggctcaat tgctggagac cgacgcggag       180
     atcgtccgtc gaccggatgg gacctgggca ctccgacgtc gcccgctggt acccagcagg       240
     gggtggcctc gctcgttcgt cgcgctcgat gtcgaaacca ccggtctccg cccagcacgg       300
     caccgcatca tcgagatcgg cgcagtgcgt tacgaggacg gctgctgcgt cgagcgcttc       360
     tcggtcctcg tcaaccccca tcggcgcttg ccggtctaca tcgtccgtct gaccgggatc       420
     cgggacgagg atctgctgac ggcaccgtcg ttcgtcgatg tggccgccgc atttcgtgtc       480
     tttttgggcg agagcacggt catcggctac aacgtggggt tcgacctcga ttttctgaac       540
     gccgaactcc ggcgcatcgg tcagggaccg ctccccaatc ccgcactcga cgtcttgccg       600
     ctcgcccggg cacttctcac cgcaaacggc cgctacgacc tcgacgcgat ctgtcgatcc       660
     atcggtctcg ctcggggcac ccgtcaccgt gcgctaccgg atgccgaagc gactgccgtc       720
     ctctatctcc acctcgtcga gcgagccgag caggtcggat accgctcgcc gagcgacctc       780
     cagccagctg ccacgcggcg aacgatcgtc gtcgagccgg tcgcccgggg gcgcgcagtc       840
     ctggaccagc gcctgctggc cgacacaccc gaacttccgg gggtgtatct catgcgcgat       900
     gcgctgggac gtgtcctgta tgtcggcaag gcgcgcaatc tcagacagcg agttcgctcc       960
     tacttcagtc aaccactggg atacacccgc aagatggacg gcttgctcga atcggtggcc      1020
     gagatcgaga cggtcgttac cggctcggag ttagaagcac tgcttttgga gagtcaattc      1080
     gtccagcggt acaagccgcc gtacaatacg caactccgca atcacgaggc atacccctac      1140
     gtgaaggtcg agctcggtcg cccctggccg cgcctgatgc tggctcgtca gcgtgacgat      1200
     gacgacgccg tgtacgtcgg gccttttcgg agcacggctg ctgcccgctc ggtcgtcgag      1260
     ttgctccacc aactcctccc tttgcgcacc tgccaccgat cgttccggga tgcccgttcc      1320
     tatgggcgcc cgtgcttgca actgacgctg ggacgctgta tcggcccatg caccggatgc      1380
     gtgacgcctg acgagtaccg agcgctcgtc gactgcgcgc tgcgttatct cagcggcgag      1440
     acgagcgtcg tcgtcgaacg tgctcaacag cttctcgctg acgcggtgga gcgactcgac      1500
     ttcgaacgag cagcgcgctt gcgcgatctc ctgcggcgca gcgaggaact cgtgttcagt      1560
     catcgattgg tccgccagac gatcagcgga cgaccgtgcg tcatcgtcac tccctgtcct      1620
     gagaccggcg atcgcgcctt tctcctcatc gttgccggac gactctgggc gcgtgtcgtg      1680
     gccgatccgc gcgagcacga tgcagccgtg gccgcccgat tgggagcggc ctgggaacgc      1740
     gcccaacagg ccgctccctg gacgctcgac caggactcgc tcgatgccgc agtgatcatc      1800
     gcgcgctggc tgtccgagca cgcggaggac ccgaccgtct tcttcctcga gcatccggtg      1860
     gactggctcg cactggtgcg gaacggtcga tcgctgcccg cgtcggcttt cgctgtccat      1920
     gccccggtgg atgacgagaa cgggacgacg aaacgaacga gaggagcaga cagtgagcga      1980
     ggaacgcagt gcgagggaac tcctggaaag catcgccgag cgcgtccgtc actgcacgcg      2040
     ctgcgatcta tggcggaccc gcactcaggc ggtgccaggt ga                         2082
//

If you have problems or comments...

PBIL Back to PBIL home page