(data stored in ACNUC30630 zone)

EMBL: CP001275.PE205

CP001275.PE205       Location/Qualifiers
FT   CDS_pept        complement(215391..215558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0208"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04864"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXM1"
FT                   /protein_id="ACM04864.1"
FT                   /translation="MLRHPVPPSLLTRVWRSIALASIRQRPLRAAAGRQDEPSTVGRVP
FT                   YQGCGTRSAG"
     ttgctccgcc atcctgttcc tccctcgcta ttgactcgcg tctggcgttc catcgcgctg        60
     gcgagtatac gccagcgccc tctccgtgca gcagctggtc ggcaggatga gccgtcgacc       120
     gtgggtcggg taccatacca ggggtgcggg acgaggagtg cgggatga                    168
//

If you have problems or comments...

PBIL Back to PBIL home page