(data stored in ACNUC30630 zone)

EMBL: CP001275.PE216

CP001275.PE216       Location/Qualifiers
FT   CDS_pept        complement(229339..230604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05453"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN2"
FT                   /protein_id="ACM05453.1"
FT                   /translation="MAIQIETSSLPVLAQPTSLEEAGLDLQLVLELALKFLYAHGTQTA
FT                   RELVEALCLPFAGLLERALSQAKREELVEITGSNGIGELGYRYALTSKGHQRAQEFLAR
FT                   NGYIGPAPVPIEQYRQIVAAQSLRHLSVTPRMIKEALGPLVFTESVLDQIGQALNSGQA
FT                   IFLFGKPGNGKTALAQRVVAMYGGAVFIPHAILVDTQIIRVFDRHHHHPLPEQPTSDRR
FT                   WMLCARPLIQVGGELTLEQLDLIYDERNRLYEAPLQLRANNGVLLIDDFGRQRVPPRAL
FT                   LNRWIVPLEQRIDILTLHTGKQVEVPFEGLVIFSTNLQPTDLVDEAFLRRIPNKIHLAN
FT                   PTVQQFAEIFRRQCAELGVPFDQRGLAYLLRTYYVGKRELRACHPRDLLRALIGAARYL
FT                   GQEPRLTPDLIDRACRSYFIDP"
     atggcgatcc agatcgaaac gagcagcctt ccagtgctag cccaaccgac gagcctggag        60
     gaggcagggc tggatctgca actcgtcctc gaactcgccc tcaagttcct ctacgcccat       120
     ggtacccaga ccgctcgcga actcgtcgaa gcattgtgtc tgccgttcgc tggcctcctg       180
     gaacgggccc tgagtcaagc gaagcgcgag gaactcgtcg agatcaccgg aagcaacggg       240
     atcggcgaac tgggctaccg ctatgccttg acgagcaaag gtcaccagcg agctcaggag       300
     ttcctggcac gcaacggata catcggccca gcaccggttc cgatcgagca gtatcgacag       360
     atcgtcgcag cgcagagtct ccgtcacctc tccgtgacac cgaggatgat caaggaagct       420
     ctcgggccac tggtcttcac cgagagcgtg ctggatcaga tcggccaggc tctgaacagc       480
     gggcaggcca ttttcctctt cggcaaaccg ggtaacggca agactgcact ggcacagcgt       540
     gtcgtcgcga tgtacggcgg tgcggtcttc atcccgcacg cgattctcgt cgacacgcag       600
     atcatccgcg tcttcgatcg ccatcaccac catcctctac ccgagcagcc gaccagtgac       660
     cgtcgctgga tgctctgcgc ccgcccgctc attcaagtcg gtggagaact gaccctcgag       720
     cagctcgatc tcatctacga tgaacgcaat cgcctctacg aggcaccgct ccagctccgg       780
     gccaacaatg gcgtgctcct gatcgacgat ttcggtcggc aacgcgtgcc accgcgtgcc       840
     ttgctcaacc gctggatcgt ccctctcgag caacggatcg atattctcac gctacacacc       900
     ggtaagcagg tcgaggttcc cttcgaggga ctcgtcatct tctcgacgaa cttgcaaccg       960
     accgacctcg tcgacgaagc ctttctccgt cgtatcccga acaagatcca cctcgcgaac      1020
     ccgacagtgc aacagtttgc ggaaattttc cgccggcagt gcgcggagct gggtgtcccg      1080
     ttcgatcagc gcggactggc ctacctcctc cgcacctact atgtcggcaa gcgcgagttg      1140
     cgggcttgtc atccccgaga tctcttacgc gcgctgatcg gtgcagctcg gtacctcggc      1200
     caggagcccc gtctgacgcc cgacctgatc gaccgtgcgt gtcgctcgta cttcatcgat      1260
     ccgtaa                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page