(data stored in ACNUC30630 zone)

EMBL: CP001275.PE218

CP001275.PE218       Location/Qualifiers
FT   CDS_pept        complement(231688..234039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0221"
FT                   /product="putative permease domain protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05808"
FT                   /db_xref="GOA:B9KXN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN4"
FT                   /protein_id="ACM05808.1"
FT                   /translation="MPIALLAAFAMRSLRLRRIRATLAGASIALAVFAVVAIRSAGLAL
FT                   IEAQQRTYAATGQPDIVASVHGLTPGLVAALARRDGVLEAESRLIQSSRLTVDGRWRAV
FT                   RLVGIERFDQLALDRPELVAGRWPERGEVVLDVTARHLLGIEIGTLVAFQANPGDPIHY
FT                   ARVSGFAWVPARPSATLLDQFTAYVPLRTLRQWTGSEAANTLLVRVDNPALAGRVASEL
FT                   QRFLAARQIPSSGWTVRDPDSFLGARELATLLLLLRAFAILGTLTALFIVANTTIGLVT
FT                   EERPQLGTLRALGTTRSQLVSAYLAPHIVIGTAGSVVGLLAGTAGGYVLTAYLAGLAGL
FT                   VLPPLRVAPSSVLLALGCGLGIAVAGALGPILHATRTPAAQLLRGDTRAPGDPPRWLTR
FT                   STGWLAQRSPILGMSTRDPFRRPLRAALTVLVTAVALAALLASQIVDHSLRAGIAALYD
FT                   RYRADAWLLTNPPVPPTYAHRLANSPPVRAAEPWVLTSGAIGSVRTDVWGLPAKTSVYQ
FT                   PVMLAGQWLDDAPAAYPPRAVITGNLARRLDAQVGDVLPLDLGRQRLPIQVSGIVDDES
FT                   TYLGATAIGKVFLDHQILTRLLGRDDRAALYALRFWDTVRPSDSLTTVEQYARTLRPLT
FT                   LLMAEDRAATERVLAVLTILARIVVLVITIATVFGITNALLLDLTERRREFGILRTLGT
FT                   ERATLVLLLAGQTLVIVVFGALLAVPVGFLLAVNILALVSRQLFAIPLALPSTVVLVLI
FT                   AAVALTTALAVLIPALLAVRLRPVEVLRYE"
     gtgccgatcg cgctgctcgc tgccttcgcg atgcgctccc tccgtttgcg ccgtatccgc        60
     gcaacgctcg ctggcgcgag catcgcgctc gccgtcttcg ccgtcgtcgc cattcggagt       120
     gctggtctgg cattgatcga ggcgcagcag cggacctatg cggcgaccgg acagccggat       180
     atcgtcgcga gcgttcatgg cctgacaccc ggcctcgtcg cagcgctggc gagacgcgac       240
     ggtgttctcg aggcggagtc gcgcctcatt cagtcgagtc gcctcaccgt ggatgggcgc       300
     tggcgggctg tccgactcgt cggcatcgag cggttcgacc aactggcact cgaccgtccc       360
     gagttggtcg ccggacggtg gccagagcgg ggcgaggtag tcctcgacgt caccgctcga       420
     cacctgctcg gtatcgaaat cgggacgctc gtcgctttcc aagccaaccc gggtgatccg       480
     attcactatg cgcgcgtgag cggcttcgcc tgggttcccg ctcgccccag tgcgacgctc       540
     ctcgaccagt tcacagccta tgtgccgctg cgcacgctac gccagtggac tggcagcgag       600
     gcagcgaaca cgttactggt ccgtgtcgac aatccggcgc tcgccggtcg agtagcgagc       660
     gaactccagc ggttcctcgc agcacgccag atcccgagca gcggttggac ggtccgcgac       720
     cccgattcgt tcctcggtgc ccgcgaactc gcgacgttgc ttctccttct gcgcgccttc       780
     gcgatactcg gtacgttgac agcactcttc atcgtcgcca acacgaccat cgggctggtc       840
     acggaggaac gcccccaact cggcaccttg cgcgccctcg gcaccacgcg gagccaactc       900
     gtcagcgcct acctggcacc acacatcgtc atcggcacgg ctggaagcgt ggtcggcctc       960
     ctcgccggga cagccggtgg gtacgtcctg accgcgtacc tggccggcct tgccgggcta      1020
     gtactcccac cgctccgagt cgcacccagc agcgtgctcc tcgcgctcgg ctgtggcctc      1080
     gggatcgcgg tggccggtgc actcggcccg atcctccacg ccacgcgaac gccagccgct      1140
     cagctcctcc gcggcgacac ccgggcaccg ggcgatccac cgcgctggct gacccgctcg      1200
     acaggctggt tggcccagcg ctctcccatt ctcggcatga gtacccgcga tcccttccgc      1260
     cgcccactcc gcgcggcact cactgtcctg gtgacggctg tggcactcgc tgcgctcctc      1320
     gccagccaga tcgtcgacca ctcgttgcgt gccggtatcg ctgcgctcta cgatcgctat      1380
     cgggcagatg cctggctctt gaccaaccca ccggttccac ccacctatgc acaccggttg      1440
     gcgaacagcc ctcctgtccg tgccgcggaa ccctgggtcc tgacatccgg cgcgatcgga      1500
     tcggtccgca ccgacgtctg ggggcttcca gcgaagacga gcgtctacca gccggtgatg      1560
     ctggctggtc agtggctcga cgacgcaccc gctgcctatc ccccccgcgc ggtcatcact      1620
     ggcaatctgg ctcggcgcct cgacgcccaa gtgggtgacg ttctccccct cgacctcggc      1680
     cgacagcgtc tcccgattca ggtcagcgga atcgtcgatg acgaaagcac ctatctgggg      1740
     gcaacggcca tcggcaaggt tttcctggat caccagatcc tcactcggct cctcggacgt      1800
     gacgatcgag cagcgctcta cgcccttcgg ttctgggaca ccgttcgacc gagcgactct      1860
     ttgacgaccg tagagcagta cgctcgcacg ctgcgcccgc tcacgcttct catggcggaa      1920
     gatcgcgccg cgaccgagcg tgtgctggcc gttttgacca tcctggcccg catcgtcgtc      1980
     ctcgtcatca ctatcgcgac cgttttcgga attaccaacg cgctgctcct cgatctcacg      2040
     gagcgccgcc gcgagtttgg catcctgcgg acgctcggga cggagcgcgc gacgctcgtg      2100
     ctgctcctgg ctggccaaac gctggttatc gtcgttttcg gcgcactact ggctgttccg      2160
     gttggctttc tgctcgccgt gaatatcctc gcgctggtga gccgccagct cttcgccatc      2220
     ccgctcgcgc ttccctcgac cgtggtgctc gttctcatcg cagcggtcgc actcacgacc      2280
     gcactcgccg tcctgatccc ggctctgctc gctgtccgac tccgccctgt cgaggtcctc      2340
     cgctatgagt ga                                                          2352
//

If you have problems or comments...

PBIL Back to PBIL home page