(data stored in ACNUC30630 zone)

EMBL: CP001275.PE220

CP001275.PE220       Location/Qualifiers
FT   CDS_pept        234320..236191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0223"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05651"
FT                   /db_xref="GOA:B9KXN6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN6"
FT                   /protein_id="ACM05651.1"
FT                   /translation="MQELERLREEIASGQATRREVLRRAAALGLSAPVIASLLAACARQ
FT                   EATPTAAPAAQTPAAAATPTPAAAATPAAQATPTQAAAKRGGGGTLRLLWWQAPTIINP
FT                   HLAQGTKDFDASNIVLEALAYFDSEDKLVPRLAEEVPSVEKGTLDPEGRWVIWKLRKGV
FT                   KWHDGQPFTAKDVKFTYEYVIDPATTATTIASYRAIESVEIVDDYTVKVTFKNPNPAWF
FT                   EPFVGGFGLIVPEHILRDYTGEKARNAPFNLKPIGTGPYKVADFKPGDVVIYEINQDYW
FT                   QEGKPYFDRVELKGGGDATSAARAVLQTGEVDWAWNLQVEAQVLLQLEKAGQGKLIITP
FT                   GPSTERIMVNFADPWTEKDGARAEPDVPHPFLTNKNIRQAIALAIRRDVIAEQLYGPAG
FT                   QVTANNLNAPARFKHPELKWEFNLEKAAQLLDEAGAKDTNGDGVREYNGKPLQILYQTS
FT                   INSIRQRTQEIVKAEMEKIGFKVELKSIDASVFFSSDPGNPDTYGHFYADLEMYTNGPS
FT                   NPFPLNWARRYHSQEVARKANNWSGVNITRYQNPEMDKVLDQLATEMNPDKQTELFRQV
FT                   NWISVTDVVEIPLVHRNSVSAATKNLTGYKPSTWASDVWDIGDWRRE"
     atgcaggaac tcgaacgact gcgggaagag atcgcgagtg gtcaggcgac gcggcgcgag        60
     gtactgcgcc gggcggcggc gctggggctc agtgcaccgg tgatcgcatc gttgctggct       120
     gcctgcgcgc gccaagaggc gacaccgact gcggctccag cggctcaaac gccggcagca       180
     gccgcgaccc cgacgccggc agcagctgcc acgccggctg ctcaggcgac accgacccag       240
     gctgcggcga aacggggtgg tggaggaacc ttgcgactgc tttggtggca ggcgccgacg       300
     atcatcaacc cgcacttggc gcaggggacg aaggacttcg atgcctcgaa catcgtcctg       360
     gaggcgttgg cctacttcga ttccgaggac aagctcgtcc cgcgcctggc cgaggaggtc       420
     ccctcggtcg agaagggaac gctggacccg gagggtcgct gggtcatctg gaagttgcgc       480
     aaaggtgtca agtggcatga cggccagcct ttcactgcca aggacgtcaa gttcacgtac       540
     gagtacgtga tcgatccagc cacgaccgcg acgacgatcg cttcgtaccg ggcgatcgaa       600
     agcgtcgaga tcgtggacga ctatacggtc aaggtcacct tcaagaatcc gaatccggcc       660
     tggttcgagc cgttcgtggg agggttcggg ttgatcgttc ccgagcacat cctgcgggac       720
     tacacgggcg agaaggcgcg caacgcgccc ttcaatctca agccgatcgg aaccggtcct       780
     tacaaagtgg cggatttcaa gccgggcgac gtggtgatct acgagatcaa ccaggactac       840
     tggcaggaag ggaagccgta cttcgatcgt gtcgagctca aaggcggtgg tgacgcgacg       900
     agcgccgcgc gggctgtcct ccagaccggt gaagttgatt gggcttggaa cctgcaggtc       960
     gaagcgcaag tgttgctgca gctcgagaaa gctgggcagg ggaagctcat catcacgcct      1020
     ggtcccagta ccgagcggat catggtgaac ttcgctgacc cgtggaccga gaaggatggt      1080
     gcccgcgctg aaccggatgt tccgcatccc ttcttgacca acaagaacat ccggcaagcg      1140
     atcgcgctgg cgatccggcg cgacgtcatc gccgagcagt tgtacggccc agctggtcag      1200
     gtgactgcca acaacctgaa tgcgccggcc cgtttcaagc atccggagct caagtgggag      1260
     ttcaacctgg aaaaggcagc ccagcttttg gacgaggcgg gcgcgaagga taccaacggt      1320
     gatggtgtcc gcgagtacaa cgggaagcca ctgcagattc tctaccagac ctcgatcaac      1380
     tccatccgcc agcggacgca agagatcgtg aaagcggaga tggagaaaat cggcttcaag      1440
     gtcgagctca agtcgatcga tgcctcggtc ttcttctcgt ccgatcctgg caatccggat      1500
     acgtatgggc acttctacgc tgacttggag atgtacacga atggtccttc caatccgttc      1560
     ccgctcaact gggcgcggcg ctatcactca caggaagtgg cgcgcaaggc caacaactgg      1620
     tcgggtgtca acattacccg ctaccagaac ccggaaatgg acaaggtgct ggaccagctg      1680
     gcgaccgaga tgaatccgga caaacagacc gaactcttcc ggcaagtgaa ctggatcagc      1740
     gtgaccgacg tcgtcgagat tccactggtc caccgcaact ctgtctctgc ggcgaccaag      1800
     aatctgactg ggtataagcc gtcaacctgg gcttccgatg tttgggacat cggtgattgg      1860
     cgccgcgagt ga                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page