(data stored in ACNUC30630 zone)

EMBL: CP001275.PE224

CP001275.PE224       Location/Qualifiers
FT   CDS_pept        complement(238078..239394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0227"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05977"
FT                   /db_xref="GOA:B9KXP0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP0"
FT                   /protein_id="ACM05977.1"
FT                   /translation="MTVQRATVDLRRLLPILIPLSAANLAAWVYLTRLWPPDLTPRTLF
FT                   TAVIFVALIVLAEQLAIDLPIPHARITVSVSSAITFAGVLTLGPTLGILVAVVGTFLDD
FT                   LIDRREPLKILANANNFALQGVVAGPLYFTLADEGSPLASMRNFLAMLLAAVVSSSFQT
FT                   VLLALVLSLASGTSAWYLWRGMARGLLVEFLALPALGSLFPILAREHPLALVLMVIPLV
FT                   GPYLAFRDYRQLHHETQSTFELLADLLDRRDPYTASHSQRVAHLTMLILDEFPELSADE
FT                   RDAIIAAARIHDLGKVATSDLILRKPGRLTDDEFAVIQRHPVDGSEILRHLTPYRHIVE
FT                   IVRHHHERWDGRGYPDGLAGEAIPFGARVIAVADTYDAMTTDRPYRRALSHEEALAELQ
FT                   RGAGTQFDPVVVAAFERALARAREAVREKTAPSMSAPVS"
     atgaccgtgc agcgtgcgac agtcgacctc cggcgacttc tgccgattct gatcccattg        60
     tcggcagcga acctggctgc ctgggtttac ctcactcggc tgtggccccc tgatttgacc       120
     ccgcgaacgc tttttactgc cgtaatcttc gtcgcgctga tcgtcctcgc cgaacaactg       180
     gcgatcgacc tgccgatccc acacgctcgc attaccgttt ccgtctcttc cgcgatcacc       240
     ttcgcgggtg tgctcactct cggaccgact ctcggtattc tcgtcgccgt ggtgggtacc       300
     ttcctcgatg atctgatcga ccggcgcgaa ccattgaaga tcctcgccaa tgcgaacaat       360
     ttcgccctgc agggtgtcgt cgccggcccc ctctacttca cgctcgccga cgagggatcc       420
     cctttggcaa gtatgcgcaa ctttctggcc atgctgctgg cagcggtggt ttcctccagc       480
     tttcagaccg ttctcctcgc gctcgttctc tcgctcgcct ctggaacgag tgcctggtac       540
     ctctggcggg ggatggcgcg cggtcttctg gtcgaatttt tggctctgcc cgcgctggga       600
     agcctgtttc ccatactcgc ccgcgagcac ccgctggccc tcgtcctcat ggtcatccca       660
     ctcgtcggcc cctaccttgc ctttcgcgat taccgccagc tccaccatga gacccagtcg       720
     acgttcgaac tcttggcgga tctcctcgat cgccgcgatc cctatactgc ttctcactcc       780
     cagcgagtcg cccacctcac catgctcatc ctggacgagt tccccgaact ctcggcggac       840
     gagcgcgatg ccatcattgc ggcggcgcgc attcacgatc tcggcaaagt ggcgacgagc       900
     gatctcattt tacgcaagcc aggtcgcttg accgacgacg agttcgccgt catccagcgt       960
     catccggtcg acggaagcga gattctccgc cacctcactc cctaccgcca catcgtcgag      1020
     atcgttcgcc atcaccatga gcgatgggac gggcgtggct atccggatgg actagccggg      1080
     gaagcgatcc ccttcggcgc acgcgtcatc gctgttgccg atacctatga tgcgatgacg      1140
     accgatcgac cctatcgtcg cgcgctcagc cacgaagaag cgctcgccga gctacagcgg      1200
     ggtgccggca cgcaattcga tcccgttgtg gtggccgcct tcgagcgagc actggcgcgg      1260
     gcacgcgagg ccgttcgcga aaagaccgcc ccctccatga gtgcgccggt ttcctga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page