(data stored in ACNUC30630 zone)

EMBL: CP001275.PE227

CP001275.PE227       Location/Qualifiers
FT   CDS_pept        241090..241803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0230"
FT                   /product="putative Stage II sporulation protein E (SpoIIE)"
FT                   /note="identified by match to protein family HMM PF07228"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05304"
FT                   /db_xref="GOA:B9KXP3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP3"
FT                   /protein_id="ACM05304.1"
FT                   /translation="MTLTIELAVAKTHRAGNRESGDTVELIERPGGGLSVVLVDAQGSG
FT                   MAAKLLSLQVAGRVLTLLNEGVRDGAAARAAHDFLFTLRGGRVSAELDIVSVDLASRTL
FT                   VVTRNSEAPLVLIRDSDVEIVASTGGRIGLYRHTRPSVTEWTLEPGLTVIVVSDGVAHA
FT                   GAHAGKTIDLATLARQESVACETAQQLADRVLSAALAADRGHPRDDMTVVVLRLQAGGV
FT                   RQPVRRLSLTFPLTE"
     gtgacgctga cgatcgagct ggctgtggcc aagacgcatc gggctggtaa ccgcgaaagc        60
     ggcgatacgg tcgaactcat cgaacgaccg ggtggcgggc tctcggtcgt cctggtcgat       120
     gcgcaaggca gcggaatggc cgcgaagctg ttgagtcttc aggtggccgg tcgtgtcctg       180
     acgctgctca atgagggggt gcgcgatggt gcggcggctc gcgccgcgca cgacttcctc       240
     tttacgctgc gcggtgggcg ggtctcggcc gaactcgata tcgtctcggt cgatctggcg       300
     agccggactt tggtggtgac gcgcaacagc gaggcaccac tcgtgctgat ccgcgacagc       360
     gacgtggaga tcgtcgcttc gaccggtggc cggatcggac tgtaccggca tacgcgcccg       420
     agtgtgaccg agtggacgct cgagccgggg ctgaccgtga tcgtcgtgag cgatggagtg       480
     gcgcatgccg gggcgcacgc cgggaaaacg atcgatcttg caacgctggc ccgccaggag       540
     tctgtggcat gcgaaacagc acagcagttg gctgaccgcg tcctgtccgc agcgctcgcg       600
     gccgatcgcg gtcatccgcg ggacgacatg acagtggtgg tgctgcggtt gcaggctggt       660
     ggggtgaggc aaccggttcg ccgactctcg ctcaccttcc cgctgaccga gtga             714
//

If you have problems or comments...

PBIL Back to PBIL home page