(data stored in ACNUC30630 zone)

EMBL: CP001275.PE242

CP001275.PE242       Location/Qualifiers
FT   CDS_pept        complement(253002..254018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0246"
FT                   /product="D-threo-aldose 1-dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04693"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXQ8"
FT                   /protein_id="ACM04693.1"
FT                   /translation="MMSLPRRVLGRTGLEVSSVCAGCAPLGDMPEAFGYRVPEEQALAT
FT                   LRAIFSSPITFLDTAAAYGDGESERRIGIVLRELGGLPPGYVLATKADRDLATGRFDAE
FT                   QVRRSVQRSLRLLGLERLQLVYFHDPEHAGLSVAEAMAPGGPVEALLALRDAGVIEHVG
FT                   VAAGPIDMLIAYIETGVFEVVITHNRYTLLNRTAEPLIQRANELGVAVVNAAPYGSGLL
FT                   AKGPSAFPRYAYREARPDEIERARTIEAVCAHYGVPLAAAALQFSLRDPRISATIVGMS
FT                   RPERVTQTIQFATWPIPDALWDELNQVEPLPYDPQTGQLVATGEGGSEDADRRRADH"
     atgatgtcgc tgcctcgtcg cgtactgggc cgcacgggac tcgaggtcag cagcgtctgc        60
     gcgggttgcg cgccgctcgg cgatatgccc gaagcgttcg gctaccgcgt gccggaagag       120
     caggctctgg cgactctgcg cgcgatcttc agcagcccga tcacgttcct cgatactgcg       180
     gctgcgtacg gtgacggtga gagcgagcga cgcatcggga tcgtcctccg cgaactcggt       240
     ggccttccac ctggctacgt tctggcgacc aaggccgacc gcgatctggc caccggccgc       300
     ttcgacgctg agcaagtccg ccgctcggtc cagcgcagcc tccgcctgct cgggctcgag       360
     cggctccagc tggtctattt tcacgacccc gagcacgctg gcttgtcggt ggctgaggcg       420
     atggcacccg gcggtccggt cgaggcactg ctcgcgctcc gcgatgcggg agtcatcgag       480
     catgtcgggg tggccgctgg tccgatcgat atgctcatcg cctacatcga aaccggcgta       540
     ttcgaggtgg tcatcaccca caatcgatac acgctcctca accggacggc cgagccgctg       600
     atccagcgtg cgaacgaact tggagtcgcc gtcgtcaatg ccgcgcccta tggaagcggc       660
     ctcctcgcca aaggaccgag tgcgttcccc cgctatgcgt atcgcgaggc acggcctgac       720
     gagatcgagc gcgcgcggac gatcgaggcg gtctgcgccc attacggtgt cccgctggcc       780
     gcggcggccc tgcagttctc gctgcgcgat cctcgcatca gcgccacgat cgtcggtatg       840
     agccgaccgg agcgtgtcac ccaaacgatc cagttcgcca cctggccgat cccggatgcc       900
     ttgtgggacg aactgaacca ggtcgaaccg cttccctacg acccacagac aggccagctc       960
     gtcgcgaccg gagagggagg aagcgaggat gccgatcgcc ggcgtgccga tcactga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page