(data stored in ACNUC30630 zone)

EMBL: CP001275.PE248

CP001275.PE248       Location/Qualifiers
FT   CDS_pept        complement(258950..259777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0252"
FT                   /product="transcriptional regulator, IclR family,
FT                   C-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04610"
FT                   /db_xref="GOA:B9KXR4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXR4"
FT                   /protein_id="ACM04610.1"
FT                   /translation="MTMPVQSPAVWRAVASLDAVARASDGLTLSEVARAIGEPKSTLHA
FT                   VLATLVEAGLLIREETSKRYRLGPHILALAGAYARQSDLIRAFTEVARPLARELGETIQ
FT                   LAILQGREVLYIGKQEGTQWVRLASEVGTRLPAHATSLGKCLLAWLPENELGCLLAEGP
FT                   LVALTPRTITDPDALRAELAQVRAQGFAIDRGETLPDVWCFGAPVRDAHGVVVAALSIS
FT                   VPVTRIGVERVEELVRAARAAADELSRQLGFSGVDDRVIDRMGIPSSRRRVAP"
     gtgacgatgc cggtacagtc tccagccgtg tggcgtgcgg tggcgagcct ggacgccgtg        60
     gcgcgagcca gcgatgggtt gacgctcagc gaagtggccc gggcgatcgg cgagccgaag       120
     agcacgctgc atgccgtcct cgcaaccttg gtcgaggccg gtctcctgat ccgggaggag       180
     accagcaaac ggtatcggct cggcccccac atcctggcac tcgctggcgc ctacgctcgt       240
     cagagcgact tgatccgcgc cttcacggag gtcgcgcgtc cgctggcccg cgaactcggc       300
     gagacgatcc agctcgccat ccttcagggg cgcgaggtgc tgtacatcgg caagcaggaa       360
     ggcacccaat gggttcgctt ggcctcggag gtcgggacgc gcctacccgc gcacgccacg       420
     tccctcggga agtgcctcct ggcctggcta ccagagaacg aactcgggtg ccttttggcc       480
     gaagggccgc tggtcgccct caccccgcgc accatcaccg atccggacgc gcttcgcgcc       540
     gagctggctc aggttcgcgc gcagggattc gccatcgatc gcggtgagac gcttcccgac       600
     gtttggtgct tcggtgcgcc ggtccgcgac gcgcatggtg tcgtcgtggc cgctctgagc       660
     atctcggtac cggtgacccg tatcggcgtc gagcgcgtgg aggaactcgt cagagcagcc       720
     cgagcggcgg ccgacgagct ttcccgacaa ctcggcttca gcggggtcga tgatcgagtg       780
     atcgatcgga tgggaattcc tagttcgagg aggagggttg caccatga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page