(data stored in ACNUC30630 zone)

EMBL: CP001275.PE26

CP001275.PE26        Location/Qualifiers
FT   CDS_pept        complement(28233..29576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0027"
FT                   /product="aminotransferase, class I and II"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04951"
FT                   /db_xref="GOA:B9L1C6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C6"
FT                   /protein_id="ACM04951.1"
FT                   /translation="MSAYRELAAAGLISGHVGRGTVVVDPAQHRESRAPAGGVPWPQLF
FT                   APLATALYDPALEDAMIAAARPDVISFATGQPAPECYPIATVRQLLDEALHREGARLLQ
FT                   YCPSEGYPPLREAIASWSQQAGIRCTAENVLVVSGSQQGLYLVARALVEPGDLVAVESP
FT                   TYAGALQIFRAVGARLLPIPVDEFGMRVSLLERALEHRRPKLIYTLPTFQNPSGATLAL
FT                   DRRLHLLDLAARAGIPVVEDDPYRELWYDAPPPPPLAALDQAGTVISLTTVSKILFPGF
FT                   RIGWIIAPWPVIRQLALVKQLVDLDTNPLMQWAIWAFLERRLLPPHLEELRRVHRDRRD
FT                   LLLASLAAEANGALHCRVPAGGLYLWCELADGIRARDLVPEAARQGVAIVPGESFFVDP
FT                   AQGRSFVRLNFTYPAPAALVEGAKRLGRALSALREARALLAQASSPIV"
     gtgagcgcct accgcgaact ggccgcagcc gggctcatca gcggtcatgt gggtcgcggg        60
     acagtcgtcg tcgatcccgc ccagcatcgc gagtcgcggg cccccgccgg cggcgtcccc       120
     tggccgcagc tcttcgctcc cctcgccacc gcgttgtacg atccggcgct cgaagatgcc       180
     atgatcgccg ccgcacgccc tgacgtcatc tccttcgcca ctggccagcc cgcgcccgaa       240
     tgctacccga tcgccaccgt gcgccagctg ctcgacgaag cgttgcaccg cgagggagcg       300
     cggcttctcc agtactgtcc cagcgagggg tatcccccac tgcgggaagc catcgctagc       360
     tggtcacagc aagccgggat ccgctgcacg gcggagaacg tcctggtcgt ctccggctcc       420
     cagcaagggc tctatctcgt cgcacgggca ctcgtcgaac cgggcgacct ggtcgcggtc       480
     gagtcaccga cttatgccgg tgcgttgcag atcttccgtg ccgtcggagc tcgcctgctc       540
     cccatcccgg tcgacgagtt cgggatgcgg gtgagcctgc tcgagcgcgc actcgagcac       600
     cggcggccca agctcatcta cacgttgccg acctttcaaa acccctccgg cgccacgctc       660
     gcactcgacc gtcgcctgca tctgctcgac ctggctgccc gcgccggcat cccggtcgtc       720
     gaggacgacc cgtaccggga actctggtac gatgcgccac cgccaccgcc gctcgcggcg       780
     ctcgaccagg ccggcaccgt catttcgctc accactgtct ccaagatcct cttcccgggt       840
     ttccgtatcg gctggatcat cgccccctgg ccggtgatcc gccagctcgc gctggtcaag       900
     caactggtcg acctggatac gaatcccctc atgcagtggg cgatttgggc ctttctcgag       960
     cgccgccttc tccccccgca tctcgaggaa ctgcggcgtg tccaccgcga tcgacgcgat      1020
     ctcctgctgg cgtcattggc agccgaagcg aacggcgcgc tccattgtcg cgtccccgcc      1080
     ggagggctct acttgtggtg cgagttggcc gatggcatcc gcgcccgcga cctcgtgccg      1140
     gaagcggccc ggcagggtgt cgccatcgtt cccggcgaaa gcttcttcgt cgatcctgcc      1200
     caagggcggt cgttcgtccg cctcaacttc acctacccgg ctcccgccgc actcgtcgag      1260
     ggagccaagc gactcggccg tgcgctgagc gcgttgcgcg aagcccgcgc cttgctcgcc      1320
     caggcgagca gcccgatcgt gtga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page