(data stored in ACNUC30630 zone)

EMBL: CP001275.PE261

CP001275.PE261       Location/Qualifiers
FT   CDS_pept        complement(271657..272916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0265"
FT                   /product="putative nuclease SbcCD, D subunit subfamily"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00619"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06125"
FT                   /db_xref="GOA:B9KXS7"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS7"
FT                   /protein_id="ACM06125.1"
FT                   /translation="MLRLIHFADLHLGVETHGQFRPDLGHSSRIQDFLDAFDQIIDAAI
FT                   EERFDAVLFAGDAFKHAEPSPTLQRRFAERIQRLLAAGIPIVLLVGNHDRPRSVVRSTP
FT                   IDIYAALRLPGVIVANRPERFTIATPSGPLQVVALPWIPPRLLLADDALREAGTPELER
FT                   RYKEVIASALAPLLAALDAATPAVFLGHLSMEGGRFGSERSVILGNDPLFGLDELGLNS
FT                   APIDYVALGHLHSHQVLHERPPVVYAGSVERIDFGEEREDKGYVAVRIAAGPYPRDVSW
FT                   EFRPLRTRPMRTFRLDILTDTPMDEIRRALERHATLIPEAIVRVTITTTPERAAAIRPL
FT                   EVRRWLSELGAAHVAGITVQTERVARPRVELERSSRHDPVSLLERWVNLHRLSDQLAKA
FT                   VIQRGREIIERVESRSSEPR"
     atgcttcgcc tgatccactt cgctgatctg catctgggcg tcgagacgca cgggcagttc        60
     cgtccggatc tcggccatag ctcccgcatc caggactttc tcgacgcctt cgatcagatc       120
     atcgatgcgg cgatcgagga gcggttcgat gccgtccttt tcgccggcga tgcgttcaaa       180
     cacgccgagc cgagcccgac ccttcagcgc cgctttgccg agcgcatcca gcgcctcctc       240
     gctgcgggaa tcccgatcgt gctcctcgtc ggaaaccatg accggccacg cagcgtggtg       300
     cgttcgacac cgatcgatat ctacgctgca ctgcgtctac ccggcgtcat cgtcgccaac       360
     cggccggagc ggttcaccat cgcgaccccg agcggcccac tccaggttgt cgcgctgccc       420
     tggataccac cccgtctcct gctggccgac gatgcgcttc gcgaggccgg cactccggaa       480
     ttggagcgtc gctacaagga agtcatcgcg tctgcgctgg ctcccctcct cgctgcactc       540
     gacgcagcga ccccggcggt tttcctcggt cacctctcga tggaaggcgg acgcttcggg       600
     agcgaacgca gcgtgatcct cggtaacgac ccgctcttcg gactcgacga gctcgggttg       660
     aacagcgctc ccatcgatta cgtcgcgctc ggccatctcc attcgcatca agtgctccac       720
     gagcggccac ccgtggtgta tgccggtagc gtcgagcgga tcgattttgg agaggagcgc       780
     gaggacaaag gctacgtcgc ggtccggatc gccgctggac catacccgcg cgacgtcagc       840
     tgggagtttc ggccgctccg tacccgcccg atgcgcacat tccgtctcga cattctgacc       900
     gacacaccga tggacgagat ccgccgcgca ctcgagcggc acgcgacgct gatcccggag       960
     gcgatcgtcc gcgtcaccat caccacgacc ccagagcgcg cggcagccat tcgtcccctc      1020
     gaggtgcggc gctggctcag cgagttgggc gccgcacacg tcgccggtat cacggtacag      1080
     accgaacgcg tcgcgcgtcc ccgcgtcgaa ctcgaacggt cctcccgtca cgatccggtg      1140
     agcctcttgg agcgctgggt caacctgcat cgtctttcgg accaactcgc caaagccgtc      1200
     atccagcgcg gccgggaaat catcgagcgc gtcgagagtc gcagctcgga gccgcgctga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page