(data stored in ACNUC30630 zone)

EMBL: CP001275.PE264

CP001275.PE264       Location/Qualifiers
FT   CDS_pept        276447..277205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0268"
FT                   /product="putative short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05680"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT0"
FT                   /protein_id="ACM05680.1"
FT                   /translation="MILGASSGFGAATARELARAGMHICGVHLDRRATLPMAEAVKADV
FT                   EAAGVEALFVNANAADAETRRQVASALRERGARVRVLMHSLAFGTLRPYIDEDAAQEVT
FT                   QKQLEMTLDVMANSLVYWTQDLFHAGLFAPDARIYAMTSEGSTRVWRGYGPVSAAKAAL
FT                   EAHVRQLAVELARYGIAVNAIQAGVTPTPAQAKIPGAEEMLREAERRNPSGRLTSPEDV
FT                   ARAIRALSAPGLGWITGNVIRVDGGEALVP"
     gtgatcctgg gcgcatccag cggatttggt gcagcgactg cccgcgagct cgctcgggcg        60
     gggatgcaca tctgcggcgt gcatttggat cgccgagcga ctttgccgat ggcagaggca       120
     gtcaaggccg acgtcgaggc tgcaggagtc gaggccctgt tcgtcaacgc caatgcggcc       180
     gatgcggaaa cccggcgaca ggtcgcttcg gcgcttcggg agcgcggcgc gcgcgtgcga       240
     gtgctgatgc attcgctcgc cttcggtacg ctgcggccgt acatcgacga ggacgccgct       300
     caagaggtga cacaaaagca attggaaatg acgctcgatg tcatggcgaa cagcttggtg       360
     tactggacac aggatctgtt ccatgccggt ctcttcgcgc cggatgcccg gatctatgcc       420
     atgaccagcg agggatcgac gcgcgtctgg cgcgggtacg gtccggtctc cgctgccaag       480
     gcggcgctcg aggcccatgt ccgccagctc gctgtggaac tcgcccgcta cgggatcgcg       540
     gtgaatgcca tccaggccgg tgtgacacct accccggcac aggccaagat tcccggtgcg       600
     gaggagatgt tgcgcgaagc cgagcggcgc aaccctagcg gacgactgac gagtccggag       660
     gacgtcgcgc gagcgatccg cgcgctcagc gcaccggggc tcgggtggat caccggcaat       720
     gtgattcggg tagatggcgg cgaggcgctg gtgccctag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page