(data stored in ACNUC30630 zone)

EMBL: CP001275.PE268

CP001275.PE268       Location/Qualifiers
FT   CDS_pept        279298..280035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0272"
FT                   /product="macrolide-specific ABC-type efflux carrier"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05817"
FT                   /db_xref="GOA:B9KXT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT4"
FT                   /protein_id="ACM05817.1"
FT                   /translation="MGTTREQERTPIVEATNVVKIYDTGRVKVPALRGVSLTVYGGEMV
FT                   AIMGPSGSGKTTLLNCLSGLDTIDEGMILIAGKELARLPDDVRSEFRARHMGFVFQLFN
FT                   LIPVLSALENVELPALLAGIRPSEARRRAWAVLEQVGLADRAGHKPAELSGGQQQRVAI
FT                   ARALVNQPDIIWADEPTGNLDTETADEVMALLRRLNRENGQTFVIVTHDPRIGSMCDRV
FT                   IQMRDGLIIDDGLASFRAAAGGE"
     atgggcacca cccgagaaca ggagcgaact ccgatcgtcg aggcaacgaa cgtcgtgaag        60
     atctacgaca cgggacgcgt gaaggttccg gcattgcgcg gcgtttcgct gaccgtgtac       120
     ggaggcgaaa tggtcgcgat catggggccc tccggaagcg ggaagacgac actcctcaac       180
     tgtctttctg gcctcgatac gatcgacgag gggatgattc tgatcgcggg gaaagagctc       240
     gcgcgcctac cggacgatgt ccgatcggaa ttccgcgctc gtcatatggg tttcgttttc       300
     cagctgttca atctcattcc ggtcttgagt gccttggaga acgtcgaact tcccgcgctt       360
     ttggcgggta tacggccgag cgaggcgaga cggcgcgcgt gggcagtgct cgagcaagtt       420
     ggtttggctg accgggctgg gcataagccg gccgagctat cgggaggcca gcagcagcgg       480
     gtggcgatcg ctcgtgccct ggtcaaccag ccggatatca tctgggccga tgagccaacc       540
     gggaacttgg acacggagac ggctgacgag gtcatggcgt tgctgcgccg gctgaaccgc       600
     gagaatggcc agaccttcgt catcgtgacc catgatccgc ggatcggctc gatgtgtgac       660
     cgcgtgatcc agatgcgcga tgggttgatc atcgacgatg gactcgcttc cttccgcgca       720
     gctgctggcg gggagtga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page