(data stored in ACNUC30630 zone)

EMBL: CP001275.PE27

CP001275.PE27        Location/Qualifiers
FT   CDS_pept        complement(29573..30691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0028"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05772"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C7"
FT                   /protein_id="ACM05772.1"
FT                   /translation="MPAKPDAGACHRRVGKAVQVTTFLPAPPITNRPVLASLARSDVEF
FT                   QRPTDDESGRPIGDCPSRAAAGPKCGRLVLRQLSFAAAAHTHTAWHARRPSPPTSDPGG
FT                   TAPRARCGRRARLQPPAGDAGQSAHGALTVARAVESAGDASPTEVEPGTVRVGGSWTWA
FT                   ETIPVRSIACDGASTRVPRSASGVCRGRAPSPSPISSASAWCPHHLVDRTGSRLRPARL
FT                   LTHRDPDRLRPDDPLPSHTPRPRAAPHQTVRLNTPPASDLVVDRPFGKRRDVSVASRGS
FT                   PIAPDWLAWMAFEAHNGTWRGSSPSVGSSSSGRLEEVSCNSGSIAPVASRSTASWLSSS
FT                   AGASSAANSRPVRACHPSAVSPPRSASTDPRS"
     atgcctgcca aacctgatgc aggcgcctgt cacaggcgcg tcgggaaagc ggtccaggtc        60
     actacctttc tgccagcccc accgatcacg aacaggcccg tgctggcgtc gctcgcgagg       120
     tccgacgtcg agttccaaag gcccaccgac gatgaatcgg gccgtccaat tggcgactgt       180
     ccgtcgcgcg cggcagccgg tccaaagtgc ggacgactcg ttctgcggca gctgtctttc       240
     gcggcagcag cgcacaccca tactgcctgg cacgcccgga ggccaagccc tcccacgagc       300
     gatcctggcg gcacagcacc acgagcgcgg tgcggacgac gagccagatt gcagccaccc       360
     gccggtgatg ccgggcaaag cgctcacggt gcgctgaccg tcgcgcgcgc agtggagtct       420
     gccggtgatg ccagcccaac cgaggtcgag ccaggcacag tccgcgttgg tggttcctgg       480
     acttgggccg agacgatacc ggtgcgctcc atcgcgtgcg acggagccag cacccgcgtg       540
     ccgcgatctg ccagcggcgt ctgccggggc cgagcgccgt cgccctcacc gatctcgtca       600
     gcatcggcat ggtgcccgca ccacctggtc gatcgaaccg gatcgcgcct ccgtccggcg       660
     aggctgctca cgcaccgcga ccccgatcgc ctacgacccg acgacccgct ccccagccac       720
     actccgcgcc cgagagccgc ccctcaccag accgtccggc tcaacacacc accagcatcc       780
     gacctcgtcg tcgaccgtcc attcgggaag cgacgagacg tttccgttgc cagcagaggg       840
     agtccaatcg cgcctgattg gttggcttgg atggcgttcg aggcgcacaa tggcacttgg       900
     cgagggtcat ctccctcggt aggctcgtca tcgagtggac gcctggagga ggtgtcatgc       960
     aactccggct cgatcgcacc agtcgcgtcc cgctctaccg ccagctggct gagcagctcc      1020
     gccggcgcat cctcagcggc gaactcccgc ccggtacgcg cttgccaccc gagcgccgtc      1080
     tcgccgccac gctcggcatc aaccgatcca cggtcgtga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page