(data stored in ACNUC30630 zone)

EMBL: CP001275.PE283

CP001275.PE283       Location/Qualifiers
FT   CDS_pept        292603..293775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0287"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04901"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU9"
FT                   /protein_id="ACM04901.1"
FT                   /translation="MIDFGKLVMAGQAAPMAIWLRDRGTERPTMLAELFAAAEDWRHSG
FT                   KRLDLGRALAQVDPSLVDPLTGLPRGSPFGLYRELLGIHFFQDIIDQLRPLSETQGAIA
FT                   LASMLGLEPWYVFATVYPRRVRREEQDPTELDVPEEVIQWIGNWALGLQMIDVAGQAVL
FT                   PEYIGRPVTAEPMVWPALLALRERIPHPLLIDEPERTDFIAAVEQWDRRIDERMFLIER
FT                   ASLAWVERYGEPPRSFARLRSGRPWRPWHYPDTFDPADGVLPQLLRAAVALVKGWGDQT
FT                   PTLFSSAKVLEIWESSRAALGPLVESAYARTVARVLDIEWALRPSRTSQSVSDDLVWRL
FT                   VLLEAILRESAGAVRALVAEPLEWIAEYRDVMEQFVEWTARFLRIGTQSG"
     atgatcgatt tcggcaagct cgtcatggcc ggacaagctg caccgatggc gatctggttg        60
     cgcgatcgcg gaacggagcg accgaccatg ctcgcggaac tcttcgcagc agccgaggac       120
     tggcgccaca gcgggaaacg actcgatctc ggccgcgcgc tcgcgcaggt cgatccctcg       180
     ctcgtcgatc cgctgaccgg cttgccgagg ggaagccctt tcgggttgta ccgagaactc       240
     ttgggtattc acttctttca agacatcatc gaccagttga ggccgctctc ggagacgcaa       300
     ggcgcgatcg ccttggcgag catgctcggt ctcgagccgt ggtacgtctt cgccacagtc       360
     tatccgcgcc gcgtgcgacg cgaggagcag gatccgacgg agctggatgt tccggaggaa       420
     gtcatccaat ggatcggaaa ctgggcgctc ggtctccaga tgatcgacgt tgccggccag       480
     gcggttttgc ccgagtacat cggacgccca gtcacggcgg agccgatggt ctggcctgcc       540
     ttgttggcgc tccgcgagcg cattccacac ccgttgctca tcgacgagcc ggagcgtacc       600
     gacttcatcg cggcggtcga gcagtgggat cgccgcatcg acgagcggat gttcctcatc       660
     gaacgggcgt cgttggcctg ggtcgagcgc tacggcgaac cgccacgctc gttcgcacgc       720
     ctccgctccg gccggccgtg gcggccgtgg cattacccgg acacgttcga tccagctgac       780
     ggtgtcctcc cccagctcct gcgcgcagca gtcgccctcg tgaagggatg gggtgaccaa       840
     acgccgacac tgttcagctc ggcaaaggtt ctggagatct gggagagcag ccgcgcggca       900
     ctcgggccac tcgtggaaag tgcctatgcg cgcacggtcg cgcgagtgct cgatatcgag       960
     tgggcgctcc gtccgtcgcg cacgagccag tccgtctccg acgacctggt gtggcgactc      1020
     gtcttgctcg aggcgatcct gcgcgagtcg gcaggtgcgg tccgcgcgct cgtcgcggaa      1080
     ccgctcgaat ggatcgccga ataccgggat gtgatggagc agttcgtcga gtggacagcg      1140
     agattcctcc ggatcggcac gcaaagtggt tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page