(data stored in ACNUC30630 zone)

EMBL: CP001275.PE286

CP001275.PE286       Location/Qualifiers
FT   CDS_pept        296156..296428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0292"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05141"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXV2"
FT                   /protein_id="ACM05141.1"
FT                   /translation="MKTRTFQLIGRRSSQPDVLLVRDQEGRYYLRPGCNGRLVRVTARD
FT                   AERLLRNYEYRPILSATWLSFEELIRTDCPLPAESTPSLTSHERA"
     atgaagacac ggacattcca gctgatcggc cgacgcagca gccaaccgga tgtccttctc        60
     gtccgtgacc aggagggtcg gtattatctc cggccgggtt gcaacgggcg ccttgtccgg       120
     gtgaccgcac gcgatgccga gcggctcctc cgcaactacg aataccgacc gatcctcagc       180
     gcaacgtggc tctcgttcga ggaactcatc cgaaccgatt gcccgcttcc tgccgagtcg       240
     acgccctcgc tcaccagtca tgagcgcgcc tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page