(data stored in ACNUC30630 zone)

EMBL: CP001275.PE294

CP001275.PE294       Location/Qualifiers
FT   CDS_pept        complement(305169..305861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0302"
FT                   /product="3-oxoadipate CoA-succinyl transferase beta
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF01144;
FT                   match to protein family HMM TIGR02428"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05247"
FT                   /db_xref="GOA:B9KXW0"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW0"
FT                   /protein_id="ACM05247.1"
FT                   /translation="MPLTREGIAYRIAHDLPDGSFVNLGFGMPSLVTHFLPLGKTVLIH
FT                   SENGILGAGPKAPPGQEDPDLVNANGDFVTLVPGASLFDHALSFTIVRGGHLTHAVLGA
FT                   LQVSRRGDLANWRIPGARVPGVGGAMDIAVGAQRVWVAMTHTTDHGEPKIVEECTYPLT
FT                   APRCVQRIYTDLAVLSVVGGELLLEEVAPGVTVQDVTARTGASLTIPSRVPTMDIPAEL
FT                   AGIQLVTV"
     atgccgctga cacgcgaggg aattgcctac cgtatcgccc atgatctccc cgacggcagc        60
     ttcgtcaacc tcggcttcgg tatgccgtca ctcgttacgc actttttgcc actcgggaaa       120
     accgtgctca ttcatagcga gaacggcatt ctcggtgccg gccccaaggc acccccgggt       180
     caagaagatc ctgatctcgt caacgctaac ggcgacttcg tcacgctcgt tccgggtgcg       240
     agtcttttcg accatgcact gtcgttcacg attgttcgag gaggtcactt gacgcatgcc       300
     gtgctcggtg ctcttcaagt ctcgcgccgg ggcgatctgg cgaactggcg catccctggt       360
     gctcgtgttc caggggtcgg cggcgccatg gacatcgccg tcggagcaca acgtgtctgg       420
     gtagcgatga cacataccac cgatcacggc gagccgaaga tcgttgaaga gtgcacctat       480
     ccgctgactg cgccgcgttg tgtccagcga atctacacgg atctcgctgt tctttccgtc       540
     gtgggcggcg aactcctcct cgaggaagtc gcaccgggcg tcacggtcca agacgttacc       600
     gcgcgcaccg gtgcatcgct gaccattccg tctcgcgtgc cgacgatgga cattccagct       660
     gaattggccg gtatccaact ggtgacggtc tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page