(data stored in ACNUC30630 zone)

EMBL: CP001275.PE301

CP001275.PE301       Location/Qualifiers
FT   CDS_pept        complement(314011..315609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0309"
FT                   /product="biuret hydrolase"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04596"
FT                   /db_xref="GOA:B9KXW7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW7"
FT                   /protein_id="ACM04596.1"
FT                   /translation="MDDTASVALARQNLAALGIPVSDEDLEKAHAAGFFSTAQVFQVMV
FT                   QRDSEVDDLPDFLTDRLPAPRSWAATGEESPSAAPEILELARALRNGETSSRALVERAL
FT                   EQITRRDQELNAFQLLLPEQALADAEARDAELARGIDRGPLHGLPVALKDLIDLAGTPT
FT                   TAGSAILANAVASRDATVVQRLRAAGAVIVGKTRLPEFAYSGASNNPHYGPVPNPRDRR
FT                   RDSGGSSSGSAAAVAAGLVVMAVGSDTGGSIRIPAAYCGIVGLKPTFGRVSARGVYPLA
FT                   WSLDHIGPLTRTVTDAAVSLEAMAGPDEDDPRTRAVPLPDLVSATQVERLELRVGVVRS
FT                   TGGDQPLAAPDAVAACERAVAALADAGADLIPLVLPELETLRIVSAAIAQLEAAALHAP
FT                   TARERWTHYGEFFRLRLLGCFAYPCWGYVAAQRLAKKARARVTSLLEEHDIALLALPTT
FT                   PTTAPPLGQWTARASWLTAPFNLLGWPALSVPAGLGDDGLPIGLQLVARPWREDLVIAA
FT                   GALVERAARSSRGSN"
     atggacgata cggcatcggt cgcactcgcc aggcaaaacc tcgcggcgtt gggcattccg        60
     gtgagcgacg aggatctcga gaaggcccac gcagcaggtt tcttcagcac cgcgcaggta       120
     ttccaggtaa tggtgcagcg agacagcgag gtcgatgacc taccagattt cctgaccgat       180
     cgtctaccag cgccgcgatc gtgggccgcg acgggagagg agtccccttc ggcggcaccg       240
     gagatcctcg aactcgcccg cgcattgcgc aacggcgaga cgagcagtcg cgcgctcgtc       300
     gagcgagcgc tcgagcagat cactcgccgc gatcaggaac tcaacgcctt tcagttgctg       360
     ctccccgagc aggcgctcgc cgatgcggag gcgcgcgatg ctgaactcgc tcgcggtatc       420
     gaccgcggac cgctccatgg cctgcccgtg gccttgaagg acctcatcga cctcgcggga       480
     acaccgacga ccgccggatc agctatcctc gccaacgcgg tggcatcacg cgatgcgacg       540
     gttgtccagc gcctccgagc cgccggagcc gtgatcgtcg ggaaaacacg actaccagag       600
     ttcgcctatt cgggagcctc caacaacccg cactacggcc cggtccccaa tccgcgagac       660
     cgtcgtcgcg acagcggggg atcctcgagt ggttctgccg ctgcagtcgc cgctggcctg       720
     gtcgtcatgg cggtcggctc ggataccggg ggatcgatcc gcattccggc ggcctattgc       780
     ggaatcgtcg gtctcaagcc gaccttcgga cgggtgagcg cgcgtggtgt ctatccgctc       840
     gcctggtcac tcgaccacat cggaccactc acccgcaccg tgacggacgc cgcggtttct       900
     ctcgaagcga tggctggtcc ggacgaggac gacccacgaa ctcgcgccgt tccactcccg       960
     gatctggtca gcgccacaca agtcgagcgt ctcgagctcc gagtgggtgt cgtccgctcc      1020
     acgggtggag accaaccttt ggccgcgccc gacgcggtcg ctgcgtgcga acgggcagtg      1080
     gccgcgctcg cggacgctgg ggccgacctg atcccgctgg tcctgccgga actcgagaca      1140
     ttgcgtatcg tgagtgcggc gatcgcgcaa ctcgaggctg ctgcgctgca cgcacccacc      1200
     gcgcgcgagc gctggaccca ctacggtgag ttcttccgtc tccgcctcct cggctgcttc      1260
     gcctacccct gctggggtta cgttgccgcc cagcgactgg cgaagaaggc tcgtgcgcgg      1320
     gtcacgagcc ttctcgagga gcacgatatc gccttgctgg ctctcccgac aacgccgacc      1380
     acagccccgc cgctcgggca gtggacagcg cgagcgagct ggctgaccgc ccccttcaac      1440
     ctgctgggat ggccagccct cagcgttccg gccggcctcg gcgatgacgg cttgccgatc      1500
     ggtctccaac tggtggcacg tccgtggcgg gaagatctcg tcatcgccgc aggagcattg      1560
     gtcgaacgcg cggctcgatc gagccgaggc tcgaactga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page