(data stored in ACNUC30630 zone)

EMBL: CP001275.PE303

CP001275.PE303       Location/Qualifiers
FT   CDS_pept        complement(316419..316862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0310"
FT                   /product="OsmC-like protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05378"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW9"
FT                   /protein_id="ACM05378.1"
FT                   /translation="MRAVARQQDSPLRCMVETTGGTIVSEAHPGVGGPGTASCSGDLLL
FT                   AALAACAQITCQMVATALGIPLTRVSATAEGDLDLRGTLGVSREVPVGFGAIRLFIDIE
FT                   APDATPEQLASLREKTEQFCVIFHTLRQPPELSVQWSSSNAQP"
     ttgcgagcag tggcccgtca gcaggacagt ccgctgcggt gcatggtcga gacgaccggt        60
     ggaacgatcg tcagcgaagc tcaccccggc gtcggcgggc caggcaccgc cagttgctcc       120
     ggtgacctgc tcctggccgc cttagccgcg tgcgcgcaga tcacttgcca gatggtcgcg       180
     accgcgctcg gcatcccgct cacgcgagtg agcgcgacag ccgagggtga cctggacctc       240
     cgcgggacgc tcggcgtgtc acgtgaggtc ccggtcgggt tcggagcgat ccgcctcttc       300
     atcgatatcg aggcaccgga cgcgacaccc gagcaactgg cgagccttcg cgagaaaacg       360
     gagcaattct gtgtcatctt ccatacgctc cgtcagccgc cagaactcag cgtgcagtgg       420
     tcctccagta acgctcagcc gtag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page