(data stored in ACNUC30630 zone)

EMBL: CP001275.PE309

CP001275.PE309       Location/Qualifiers
FT   CDS_pept        323225..324049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0317"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04532"
FT                   /db_xref="GOA:B9KXX5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXX5"
FT                   /protein_id="ACM04532.1"
FT                   /translation="MVETPGASSAPTEARTVVVRVSDVIKHFVHGKRQLRALDGVSFEL
FT                   PEGRFLVVVGPSGCGKTTLLRILAGLEQQDSGEVWMRPSRDGHPPFAMVFQEQSVFPWL
FT                   TVRDNVAYGLKLRRVRGRQVEERASHWIRKVGLSGFERAYPHQLSGGMKQRVSIARAFA
FT                   VDPDVLLMDEPFSALDEQMRTILQQEVSSLCEEQQKTVIFVTHSIDEALTLGDEVLVMT
FT                   HRPGRVKRVIPVPFPRPRDVVEVRADPRYGELYEEIWGLIAEEVRRGPQEHR"
     atggttgaga ccccgggcgc gtcatcggct ccgacagagg cgcgcactgt cgtggtgaga        60
     gtatcggacg tcatcaagca tttcgttcat ggaaaacgac aactccgagc actggacggt       120
     gtgagcttcg agctcccgga gggacgcttt ttggttgtcg tcgggccgag cggttgcggc       180
     aagacgacgt tgcttcgcat tctggctggt ttggagcagc aggacagtgg cgaagtctgg       240
     atgcgtccca gtcgcgatgg gcatccgccg tttgccatgg tcttccaaga acaatcggtc       300
     ttcccatggc tgacggtgcg tgacaacgtt gcctacggcc tcaagctgcg ccgcgtacga       360
     gggcggcagg tcgaggaacg ggcatcgcac tggatccgca aggtcgggct gagcggattc       420
     gaacgagcct atccgcatca gctctcgggc ggaatgaagc agcgggtctc gatcgcgcgg       480
     gctttcgcgg tcgatcctga tgtccttctc atggacgagc cattctcggc gctggacgag       540
     cagatgcgga cgattctgca gcaggaagtc tcgagtcttt gcgaagagca gcaaaagact       600
     gtcatcttcg tgacgcattc gatcgacgag gctctcacac tcggtgacga ggttttagtg       660
     atgactcatc gaccaggacg ggtcaagcgg gtgataccgg ttccgtttcc acgtccccgc       720
     gacgtggtcg aggtacgagc tgatccacgg tacggtgaac tctatgaaga gatttggggg       780
     ttgatcgccg aagaggtacg gcgtggacca caggagcatc gatga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page