(data stored in ACNUC30630 zone)

EMBL: CP001275.PE321

CP001275.PE321       Location/Qualifiers
FT   CDS_pept        complement(332689..333156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0329"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05909"
FT                   /db_xref="GOA:B9KXY7"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXY7"
FT                   /protein_id="ACM05909.1"
FT                   /translation="MRNPFDWDYLTAPLWQMPTWGPLSITYVVVFSLGFLTCLWIYNDP
FT                   RRLIRKRDPLLADFLQRIAGWGLIVFGIGLFFFLFRLGRISAFDLYKRIWLYLSALLVL
FT                   VWTAYAAHLLLRVYPPLARQRAEELRRKQYAMTPKRAARRATSAASPRKPR"
     atgcgtaatc cgttcgactg ggactacctg accgctccgc tctggcaaat gcctacttgg        60
     ggaccgctct cgatcacgta cgtcgtcgtt ttctcgctcg gtttcctcac ctgtctctgg       120
     atctacaacg acccacgccg actcatccgc aagcgcgatc ctctcctggc cgacttcctg       180
     cagcgcatcg ctggatgggg tctcatcgtc ttcggcatag gactcttctt ctttctcttc       240
     cggctcggcc gcatcagtgc cttcgatctc tacaagcgga tctggctgta tctcagcgcc       300
     ctcttggtac tcgtgtggac agcgtatgcc gcgcacctgc tgcttcgcgt ctatccaccc       360
     ctcgcgcggc agcgcgccga agagctccgg cgcaagcagt acgcgatgac ccccaagcga       420
     gcagctcgcc gtgcaacctc ggcagcatct ccacgcaagc ctcgctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page