(data stored in ACNUC30630 zone)

EMBL: CP001275.PE325

CP001275.PE325       Location/Qualifiers
FT   CDS_pept        complement(336032..336451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0333"
FT                   /product="succinate dehydrogenase, cytochrome subunit"
FT                   /note="identified by match to protein family HMM PF01127;
FT                   match to protein family HMM TIGR02970"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05216"
FT                   /db_xref="GOA:B9KXZ1"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXZ1"
FT                   /protein_id="ACM05216.1"
FT                   /translation="MTVTRAQESRSATTRGISAYRGYRPPPGMISWAFHRITGLGVLLF
FT                   LLLHIVDIFLVNYGPEVFNELLFLYRHPVFRIGEIILVGAVYYHAANGVRIMLIDFWPA
FT                   AYRYERQLFYGVMAVFLLAFIPTAFLMIRAIIQAG"
     atgacggtca cgcgagcgca agagtcgcga tcagcgacga cgcgtggaat cagcgcctat        60
     cgaggctatc gaccaccacc tggcatgatt tcctgggcat ttcaccgcat taccggcctc       120
     ggggttctgt tgttcctctt actgcacatc gtggacatct tcctcgtgaa ctacggtcct       180
     gaggtgttca acgagttgct ctttctctac cggcaccccg ttttccggat cggcgaaatc       240
     atcttggttg gcgcggtcta ttatcacgca gctaatggtg tacgcatcat gctcatcgac       300
     ttctggccag ccgcttatcg ttacgaacgg cagctcttct atggtgtcat ggcggtcttc       360
     ctgctcgcct tcatccccac tgccttcctg atgatccgcg cgatcatcca agctggctga       420
//

If you have problems or comments...

PBIL Back to PBIL home page