(data stored in ACNUC30630 zone)

EMBL: CP001275.PE341

CP001275.PE341       Location/Qualifiers
FT   CDS_pept        351819..352988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0350"
FT                   /product="putative peptide chain release factor subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05819"
FT                   /db_xref="GOA:B9KY07"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR041202"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY07"
FT                   /protein_id="ACM05819.1"
FT                   /translation="MEITRREVEGLGALRSDEWPIISLYLRVDKEHITDDHYSIRLKNL
FT                   LKELERAREQIGLNRAQSQAVDEDVERIRAFFRDHGDEFGQGVALFASSRAGLWRVYHV
FT                   PREVGNEADLDFRPVIGRLVRVVELFEPICTCVISRDRARIFRGHLVNFQEVAVRLDEE
FT                   VPGQHGQGGWSQARFARHIEDHVRQHFQRVGQVLFQLFEQDPFRFLVVAGPDEVVADFV
FT                   DGLHPYLRERYVGSFNCLMEATAKEIREETKRIVTAWQEQERQRYVDLVLEEALSQDMA
FT                   VVGLDRVVEVVQMQNVNSLVVDDQLSAPGRYCLRCGALQPIGSEASECVFCGGLTRMRE
FT                   NIVPEVYAEAYRQNANLVFLSERDLRARLEPFGGIGAILRYRIGAPATS"
     gtggagataa cgcgtcgtga agtcgaaggc ttgggagcac tgcgcagcga cgaatggccg        60
     atcatcagtc tctacttacg agtcgataaa gagcatatca cggacgatca ctattcgatt       120
     cggttgaaga acttgctcaa ggagttggag cgagcgcggg aacagattgg actgaatcga       180
     gcacagtccc aagcggtcga cgaggatgtc gaacggatcc gcgccttctt ccgcgatcat       240
     ggcgacgagt tcggtcaggg agtggccctc ttcgcgagta gccgggctgg cctttggcgc       300
     gtctatcatg tgccgcgaga ggtcgggaat gaagccgatc tcgattttcg gcctgtcatc       360
     gggcgcctgg tgcgcgtggt cgagttgttc gagccgatct gtacgtgtgt gatttcgcga       420
     gaccgggcaa ggatcttccg cggccatttg gtgaactttc aagaagtcgc cgtacgactg       480
     gacgaggaag ttcccggcca gcatgggcaa gggggctggt cgcaggcgcg ttttgcccgc       540
     cacatcgagg atcatgtgcg ccagcatttt cagcgggtcg ggcaagtgct gttccaactg       600
     ttcgagcaag atccgttccg gtttctcgtg gtcgctggtc ccgacgaggt ggtcgcggac       660
     ttcgtcgatg gcctgcatcc gtacttgcgc gagcgctatg tcggatcctt caactgtttg       720
     atggaggcga cagccaagga gatccgcgag gagaccaagc gcatcgtgac ggcgtggcag       780
     gagcaggagc ggcaacgcta tgtcgacttg gtgctggagg aggcactcag tcaagacatg       840
     gcggtggtcg ggctcgatcg cgtcgtcgaa gtggtacaga tgcagaatgt caacagtctc       900
     gtcgtcgatg accagctgag tgcgccgggg cgatactgcc tgcgctgcgg tgccctgcaa       960
     ccgatcggca gtgaggcgag cgagtgcgtg ttctgtggtg gcctgacgcg catgcgcgag      1020
     aatatcgtgc cggaagtcta cgccgaggct tatcgacaga acgcgaatct cgtcttcctg      1080
     agtgagcggg atttacgcgc tcgactcgag ccgttcggcg gcatcggggc gatcctacgg      1140
     tatcgaatcg gggcgccggc gacctcatga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page