(data stored in ACNUC30630 zone)

EMBL: CP001275.PE343

CP001275.PE343       Location/Qualifiers
FT   CDS_pept        complement(353916..354782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06062"
FT                   /db_xref="GOA:B9KY09"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY09"
FT                   /protein_id="ACM06062.1"
FT                   /translation="MSEFGELLRNARAYRGVTLLDAERATRINRRYLAALEQEAFEQLP
FT                   PLTYARGIVRLYAQYLGLDPVTVLAKFEEAHGQRSMGFRVVPSVQPVREPLMHWAPNFA
FT                   VIVFMLALSAIVFALVYTTYLVPRETSPTPEASSVATSAEAVMPTVTGVVSAPAATATT
FT                   VPTAPPGTVPVNPAANATASPASAASTEAKPEHSPTPGTSGTPAPAGPATTEHTFEIVT
FT                   MGRVWVQVTVDGRTVLAEVLNEGDRRSFRGKTMTVSSGNAPLVRIIVDGQDRGPLGQRW
FT                   DATASYP"
     atgagtgagt tcggggaatt attgcggaac gcacgcgcgt accgtggcgt gacgctcctc        60
     gacgccgagc gtgcgacccg catcaaccgg cgttatctcg ctgcgctcga acaggaagcg       120
     ttcgagcagc tcccacccct gacctacgcg cgtggcatcg tccgcctcta cgcccagtac       180
     ctgggcctcg atccggtcac ggtcctcgcc aagttcgagg aagcgcatgg tcagcgcagc       240
     atgggattcc gcgtcgtccc ctcggtgcag cccgtacgag aaccgctcat gcactgggca       300
     ccgaacttcg ctgtgatcgt cttcatgctc gctctctccg cgatcgtgtt cgcactcgtc       360
     tacacgacct acctcgttcc ccgcgagaca tcgcccacac cggaggcgag cagcgtcgcc       420
     accagcgcgg aagcagtcat gccgacagtg accggcgtgg tttccgctcc ggcagcgact       480
     gccacgaccg tccccaccgc gcccccaggc accgtaccgg tgaaccccgc ggcgaacgca       540
     acggcatctc ctgcctctgc ggcctccacc gaagcgaaac cggagcattc ccccacgcca       600
     ggaacatcgg gaacaccggc gcctgccgga ccggcgacaa ccgagcatac tttcgagatc       660
     gtgaccatgg gtcgggtctg ggttcaggtg accgtggatg gtcgcacggt gctcgctgaa       720
     gtgctgaatg agggagaccg acggagtttc cgcggtaaga cgatgacggt cagctcgggt       780
     aatgcgccac tcgttcggat catcgtcgac ggccaggatc gcgggccgct gggccaacgt       840
     tgggacgcaa ccgccagcta cccgtga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page