(data stored in ACNUC30630 zone)

EMBL: CP001275.PE348

CP001275.PE348       Location/Qualifiers
FT   CDS_pept        complement(358425..359237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0357"
FT                   /product="Protein of unknown function superfamily"
FT                   /note="identified by match to protein family HMM PF01887"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04990"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY14"
FT                   /protein_id="ACM04990.1"
FT                   /translation="MLTTWRPSGIVTFTSDYGVRDSYVAQVKGVILERAPTSTIIDVTH
FT                   EIAAQDILEGAFQLATAWRAFPVGTIHLAVVDPGVGSERRAVSILADGHAFVLPDNGLA
FT                   TFVLAEAHQVAAWSLDRSEWFRQPVAPTFHGRDIFGPICGLLASGMSLAEVGTPLDPAS
FT                   LVKLPIQPVIASGGSVVGPIVSIDRFGNCRTLIRREQLPDESETLCIRCGQLELLGIVR
FT                   TFADVAPGMPLAYFGSHGGLEIAVRDGNAAATWHLERGMLVEVRRAVK"
     atgctgacca cctggcggcc ttcagggatc gtgacgttta ccagtgacta tggcgtgcgt        60
     gacagctatg tggcacaggt caagggagtg atcctcgaac gagctcccac gagcacgatc       120
     atcgatgtca cgcacgagat agcagcccag gacatcctcg agggagcgtt ccaactcgca       180
     accgcttggc gtgcctttcc tgtcggcacg atccatctgg ctgtggtcga tcccggtgtg       240
     ggtagcgagc gacgcgcggt ctcgatcctg gcggatggtc atgccttcgt cctgcccgac       300
     aacggacttg cgaccttcgt cctcgcggag gcgcaccagg tcgctgcttg gtcgctcgat       360
     cgatcagagt ggttccgcca gccggttgca cccaccttcc atgggcgaga catcttcggc       420
     ccgatctgtg gtctgctcgc cagcgggatg tccctggcag aagtcggtac gccgctcgac       480
     ccggcgtcct tggtgaaact cccgatccag ccggtcatcg cgagcggagg aagcgtcgtc       540
     ggtcccatcg tgtcgatcga tcgtttcggg aattgccgca ccttgatccg gcgcgagcag       600
     cttcctgacg aatcggaaac gctctgcatc cgctgcggtc agctggagtt gctcggtatc       660
     gtgcgcacct tcgccgatgt cgcccctggc atgccgctcg cctatttcgg cagccacggt       720
     ggcttggaaa tcgccgtccg cgacggcaat gctgcggcaa cctggcacct cgagcggggc       780
     atgttggtcg aagtccgccg cgcggtcaaa tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page