(data stored in ACNUC30630 zone)

EMBL: CP001275.PE367

CP001275.PE367       Location/Qualifiers
FT   CDS_pept        complement(378659..379072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0376"
FT                   /product="Domain of unknown function domain protein"
FT                   /note="identified by match to protein family HMM PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04983"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY33"
FT                   /protein_id="ACM04983.1"
FT                   /translation="MIGTKGRDPMQKRSDDLARRLFGDSTTEGGEMAKFTEDDVRERLK
FT                   QVIDPELGVDVVNLGLIYGIDLIDREDGKTDVLITMTLTTFGCPLGPILTEEVNYALRD
FT                   LPDLGNVEVNLVWSPPWTPDMMSEEAKDALGIW"
     gtgatcggta cgaagggacg cgacccgatg cagaagcgat ccgacgacct tgcgcgccgc        60
     ttgttcggcg attccacaac agaaggaggc gagatggcga agttcaccga agatgatgtc       120
     cgcgagcgtc tgaagcaggt catcgaccct gagctcggcg tcgatgtggt gaacctggga       180
     ttgatctatg gcatcgatct catcgaccgg gaggacggca agacggacgt actgatcacg       240
     atgacgttga ccacattcgg ctgccctctg gggccgatcc tgaccgagga ggtgaattac       300
     gcactccgcg atctccccga tctcggcaac gtggaggtca atctcgtctg gagcccgccc       360
     tggacaccgg acatgatgag cgaagaggca aaagacgcct tggggatctg gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page