(data stored in ACNUC30630 zone)

EMBL: CP001275.PE369

CP001275.PE369       Location/Qualifiers
FT   CDS_pept        complement(379472..380731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0378"
FT                   /product="cysteine desulfurase"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM TIGR01979"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05280"
FT                   /db_xref="GOA:B9KY35"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY35"
FT                   /protein_id="ACM05280.1"
FT                   /translation="MTSFTGTQPLDVERIRGDFPIFQRTVRGGRPLVYLDSAATSQKPA
FT                   SVIEALAGFYRTSNANIHRGIYELSEEASVLYEEARAKVARFIGASRAQEVVFVRNTTE
FT                   AINLVARTWGTTALQPGDVVVTTILEHHSNIVPWHQLAVERGIIVRFVDIDEHGRLRLD
FT                   QLEELLDAYPVKLVAVTHVSNALGTINPIPEIVRLAHRTGALVLVDGAQSVPHLPVNVR
FT                   ELGADFLAFSGHKMLAPFGIGVLWARYDLLTSLPPFLGGGGMIRTVTTDGFSPGDVPAR
FT                   FEAGTPSVADAVALGAAIDYLESIGMAAIRQHERALLAYALPRLEEIPGIRLYGPVGDD
FT                   RSGVISFTIGDVHPHDVAAVLDQHGIAVRAGHHCTQPLMRRLGVVATTRASFYLYNAED
FT                   DVDRLIEALREVRRVFGVAG"
     atgacgtcgt tcactggaac gcagccactc gacgtcgagc ggatccgagg ggacttcccg        60
     atcttccagc ggacggttcg cggcggcaga cccctcgtgt atctcgatag cgcggcaacc       120
     tcacagaagc cagcgagcgt catcgaggcg ctcgctggct tctatcgtac gagcaacgcc       180
     aacattcacc gcggcatcta cgagttgagc gaggaggcct cggtcctcta tgaggaagcg       240
     cgcgccaaag tcgcgcgctt catcggcgct agccgcgcgc aagaggtcgt cttcgtccgc       300
     aatacgacgg aggcgatcaa cctggtggcc agaacatggg gtaccaccgc gctccagcca       360
     ggagacgtcg tcgtgacgac gatcctcgag caccactcga atatcgtccc ctggcatcag       420
     ctcgccgtcg agcgcggaat catcgtccgc ttcgtcgata tcgacgagca cggccggctc       480
     cgactcgatc aacttgagga gttactggac gcatatccgg tcaagctggt cgctgtgacg       540
     cacgtttcga atgcactggg gaccatcaat cccatcccgg agatcgttcg tctcgcccac       600
     cgtaccggtg cactcgtgct ggtcgatggt gcacagagcg ttcctcatct accggtcaac       660
     gtccgcgaac tcggagccga tttcctggca ttttccggcc acaagatgct cgcgccattc       720
     gggatcggcg ttctctgggc ccgctacgac ttgcttacca gcttgccacc attcctcggt       780
     ggcggtggca tgatccgcac ggtcacgacc gacggttttt caccaggtga cgtaccagcc       840
     cgcttcgagg ctggaacacc gagcgtggct gacgcggtcg ccctgggagc cgcgatcgac       900
     tatctggagt cgatcgggat ggcagccata cggcaacacg agcgagctct gctggcctac       960
     gctctccccc gcttggagga aattccgggc atccggctct atgggccggt cggtgatgat      1020
     cgaagcggtg tcatcagctt cacgatcggc gacgtccatc cccatgacgt cgccgccgtg      1080
     ctcgatcagc acgggatcgc tgtccgcgct ggccaccatt gcacgcaacc cttgatgcgg      1140
     cgcctcggcg tcgtggcgac gacgcgcgcc agtttctacc tttacaatgc cgaggacgac      1200
     gtggatcgcc tcatcgaggc actccgcgag gtacgtcgcg ttttcggcgt cgcggggtga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page