(data stored in ACNUC30630 zone)

EMBL: CP001275.PE374

CP001275.PE374       Location/Qualifiers
FT   CDS_pept        385014..385484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0384"
FT                   /product="NifU family protein"
FT                   /note="identified by match to protein family HMM PF01592"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05779"
FT                   /db_xref="GOA:B9KY40"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY40"
FT                   /protein_id="ACM05779.1"
FT                   /translation="MEQIVEHYRRPRHRHALPDADVVMPGGNPGCGDIVTIYLKVDEQG
FT                   HLIAEASFEGEGCTISQAAADILLDVVNEERWTLEQVLEADYHLMEELIGEEAVKLRPR
FT                   CATLALGTLKAAVTKYLRDQLRREAGLEVVERENERFGIVTGELPSAEASHS"
     atggagcaga tcgtcgagca ctaccgccgg ccacgtcacc gccacgctct gccggatgcc        60
     gatgtggtga tgcctggggg caatccaggc tgcggcgata tcgtcaccat ctatctcaag       120
     gtcgacgagc aggggcacct gatcgcggag gcttcgttcg aaggcgaggg gtgtacgatc       180
     agccaagcag cggcggatat cctgctcgac gtcgtgaatg aagagcgatg gacgctcgag       240
     caggttctgg aagccgacta ccacttgatg gaagagctca tcggcgagga ggcagtcaag       300
     ctccggcccc gctgcgcgac actggccctc ggaacgctca aagcggcggt cacgaaatac       360
     ttgcgcgacc agctgcgtcg cgaggccggt ctcgaggtgg tcgaacggga gaacgagcgc       420
     ttcggcatcg tgaccggaga gctgccatcg gctgaggcat cgcacagcta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page