(data stored in ACNUC30630 zone)

EMBL: CP001275.PE385

CP001275.PE385       Location/Qualifiers
FT   CDS_pept        394307..396139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0394"
FT                   /product="putative ABC transporter, substrate binding
FT                   protein (oligopeptide)"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04538"
FT                   /db_xref="GOA:B9KY51"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY51"
FT                   /protein_id="ACM04538.1"
FT                   /translation="MHVRNEVHRAMSAVSQDRRVWLLEDVRCEMKRGRIRALLRLVSVL
FT                   ALALPILAACARGQATPTPAPSGATPTAGQTPAAVSSPTQAAVTTPTGEKVLRIHEYTY
FT                   PDVFDPQKSSFSNEIAVLHMNYEGLTRLDKDLNTVPAAAESWEFNQDGTVVTFHLRAGL
FT                   KYSDGTPLTAERFRYAVERTCDPKTAGEYQSILFDIVGCEEFAGTDPNDQAAYEAARQK
FT                   LGVEAPDDRTLIVRLTHPAPYFPTIASLWVFYPARKELIEQGGENWWKDPKLQIGNGPF
FT                   QMVEVVEDQRIRFVANTNYWEGRPKLDAVEIIYQKESSVALEAYKAGQLDMFSPDPSQL
FT                   PAIKSDPELSKQLVTYPAATTIQLSFNLTKEPFTDKKVREAFAYAFDRKTYCEQIRNGD
FT                   CTPTLEWIPPGIPGHIGTDKYGFDPAKAKQALAESKYGGPDKLPEIKLTFNSDDPAARP
FT                   RVEWIAGQYRDILGVNITLEPVDGKTLVAMRKDPSTYPQMTMAGWIQDYPDPQNWLSVY
FT                   WKCDATFAQRFGYCNKQFDELVTKADQELDQQKRIELYKQAHQILIDDVPGPFLYNPLN
FT                   IWLVKPSVTGYSPTPSDDAFPGEFASLMTLDIKK"
     gtgcacgtcc ggaacgaggt ccaccgagcg atgagcgcgg tgagtcagga tcgtcgagtc        60
     tggctgttgg aagacgtgag gtgcgagatg aaacgagggc gaatacgtgc gcttttgcgt       120
     ctcgtctcgg tgttggcgct ggcgttaccg attttggcgg cgtgcgcgcg cggtcaagcg       180
     acgccgactc cagcaccgag cggggcaact ccgacagcgg gccagacgcc ggctgctgtg       240
     agcagtccga cgcaagcagc agtcacaacg ccgactggtg agaaggtcct gcggattcac       300
     gagtacacgt atccggacgt cttcgacccg cagaagagct ccttctcgaa cgagatcgcc       360
     gttctccaca tgaattacga gggactcacg cggttggaca aggatctcaa caccgtgcca       420
     gccgccgctg agtcgtggga attcaaccaa gatggtacgg tcgtcacttt ccacctgcgc       480
     gccgggttga agtacagcga tggaacgccg ctcacggctg agcgcttccg ctacgcggtc       540
     gagcggacgt gtgatcccaa gacagctgga gaataccaat cgatcctgtt cgacatcgtg       600
     gggtgcgaag agttcgctgg taccgatccc aatgatcagg cagcgtatga ggccgctcgt       660
     cagaaactgg gtgtcgaggc accggatgat cggacgctga tcgttcgctt gactcatccg       720
     gctccctatt tcccgacgat cgcgtcgttg tgggtcttct atccggcccg caaggagctg       780
     atcgagcaag gcggtgagaa ctggtggaag gatcccaagc ttcagatcgg taatggcccg       840
     ttccagatgg ttgaagtcgt cgaggatcag cgcatccgct tcgtcgcgaa cacgaactac       900
     tgggaaggcc ggccgaagct ggatgcggtc gagattatct accagaaaga gagctcggtc       960
     gcgctcgagg cgtacaaggc tggacagctc gacatgttct cgccggatcc ctcacagctc      1020
     ccagcgatca agagcgatcc ggagctgtcc aagcagctcg tgacctaccc ggcagcgacg      1080
     accattcagc tctccttcaa cttgacgaag gagccgttca cggacaagaa ggtgcgcgag      1140
     gctttcgcct acgcattcga tcgcaagacc tactgcgagc agatccggaa cggcgactgc      1200
     acaccgacgc tcgaatggat tccaccgggt attccgggtc atatcgggac cgacaagtac      1260
     gggttcgacc cggcgaaagc caaacaggct ctggcagagt cgaagtacgg tggcccggac      1320
     aagctaccgg agatcaagtt gacattcaat agcgacgatc ctgcagcgcg tccgcgagtc      1380
     gagtggattg ctggacagta tcgcgacatc ctcggggtga acatcacgct cgagccggtg      1440
     gatggcaaga cactcgtcgc gatgcgcaag gatcccagca catacccgca gatgaccatg      1500
     gcgggatgga tccaggacta tccggatccc cagaactggc tcagcgtcta ctggaagtgc      1560
     gatgcgacct ttgcccagcg cttcggctat tgcaacaagc agttcgatga gctcgtgacc      1620
     aaggccgatc aggaactcga ccagcagaag cggatcgagc tgtataagca ggcgcatcag      1680
     atcctgatcg acgatgtacc ggggccgttc ctctataacc cgctgaacat ctggctggtt      1740
     aagccgtccg tgaccgggta cagcccgacg ccgagcgacg atgcgttccc gggcgagttc      1800
     gcgtcactca tgacgctgga tatcaagaag tag                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page