(data stored in ACNUC30630 zone)

EMBL: CP001275.PE39

CP001275.PE39        Location/Qualifiers
FT   CDS_pept        45464..46237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0041"
FT                   /product="3-hydroxybutyryl-CoA dehydratase"
FT                   /EC_number="4.2.1.55"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06060"
FT                   /db_xref="GOA:B9L259"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9L259"
FT                   /protein_id="ACM06060.1"
FT                   /translation="MSVRVEREGAITLVTVERPERLNALDTATLRALLAAVQELATEEA
FT                   IAVVVLTGAGDRAFIAGADISEMVEKSPAEALAFAELGHAVCRAIEEAPQPYIAAVNGY
FT                   ALGGGCEIALACDIRLASERAVFAQPEVTLGIPPGWGGSQRLPRVVPPGIARELLYTGR
FT                   RVDAQEALRIGLVNAVYPADQLLERARELANRIAANGPLAVRLTKAAVRFGLEQGLEAG
FT                   LTYERQVFAYAFTTEDQREGMRAFLEKRRPAFRGR"
     atgagcgtgc gtgtcgagcg ggagggggcg atcaccctcg tcacggtcga gcgcccggaa        60
     cgactgaacg cgctcgatac cgcgacgttg cgtgccttac tcgcggcagt gcaggaactg       120
     gcaacggagg aggcgatcgc tgtcgtcgtc ctcaccgggg caggcgatcg cgcgttcatc       180
     gccggagccg atatcagcga gatggtagag aagtcgccag ccgaggcgct cgccttcgcc       240
     gagttgggac acgccgtttg ccgggcgatc gaggaagcgc cgcaaccgta catcgcagcg       300
     gtcaatggct acgcgctagg aggcggctgc gagatcgcgc tggcgtgcga tatccgcctc       360
     gccagcgagc gcgccgtctt cgcccagccg gaagtaacgc tgggtattcc accaggctgg       420
     ggcggatcgc aacggctgcc gcgcgtcgtt cctcctggta tcgcgcgcga gttgctctat       480
     acggggcgcc gcgtcgatgc gcaggaagca ctgcggatcg ggctcgtcaa tgccgtctat       540
     ccggctgacc aactcctcga gcgagctcgg gaactggcga accggatcgc ggccaacggg       600
     ccactcgcgg tccgcttgac caaggcggcg gttcgcttcg gtctcgagca ggggctggaa       660
     gctggactga cctacgagcg gcaggtgttc gcgtacgcgt tcaccaccga ggatcagcgg       720
     gaggggatgc gggcatttct ggaaaagcgt cgtccggctt ttcgcgggcg ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page