(data stored in ACNUC30630 zone)

EMBL: CP001275.PE403

CP001275.PE403       Location/Qualifiers
FT   CDS_pept        complement(410967..411905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0412"
FT                   /product="Luciferase-like monooxygenase superfamily"
FT                   /note="identified by match to protein family HMM PF00296;
FT                   match to protein family HMM TIGR03560"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05259"
FT                   /db_xref="GOA:B9KY69"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY69"
FT                   /protein_id="ACM05259.1"
FT                   /translation="MPGMQFGIHVGPQNTTTDELRQLWRFADAHGFSWFSVWDHFYART
FT                   SDRIPHYEAVALLAALACDTQRIRFGCMVFAVQFRNIGLLAKSIVTIDHLSNGRLEVGL
FT                   GAGWHEPEYRAFGYPFLSDRERLDQLEEGITALRRLLQEDAVTFEGRWIQLREARVYPK
FT                   PLQPRLPLWIGGAGERRTARIAARHADGWNIPYVSPEGFRQKRAALEHWCEVEGRDPAT
FT                   LQIAVQVGLYMATEDDERTVSRLRERLVEQVGPQALEQPGWLIGGPDRISALLAEYHAA
FT                   GADWINVTVRPPVDFEALQAFVERVMPHFAS"
     atgccgggga tgcagttcgg gattcatgtc ggtccgcaaa acacgacgac tgacgaactc        60
     cgccaactct ggcgcttcgc tgatgcccat ggtttctcct ggttttcggt ctgggatcac       120
     ttttatgccc ggacatccga ccgcatccca cactacgagg ctgtcgccct gctcgctgca       180
     ctcgcttgcg atacccagcg catccggttc ggttgtatgg ttttcgccgt tcagttccgc       240
     aacatcggcc tgctggccaa atcgatcgtg accatcgatc acttgagcaa cgggcgattg       300
     gaggtcgggc tgggcgctgg ctggcacgag ccggaatatc gcgcctttgg ctacccgttc       360
     ctgtccgatc gcgagcgact cgatcagctg gaagaaggaa tcacggcctt gcgccggctc       420
     ctccaggaag atgcggtgac gttcgagggt cgctggattc agctccgtga ggcccgcgtc       480
     tatcccaaac cgctccagcc gaggctgccg ctgtggatcg gcggtgccgg tgagcgccgg       540
     acagcccgca tcgcggcacg acatgccgat ggctggaaca ttccttacgt cagcccggaa       600
     ggcttccgcc agaagcgagc agcactggag cactggtgcg aggtcgaagg gcgcgacccc       660
     gcgacgctcc agatcgccgt tcaggtcggg ctctacatgg ccacggaaga cgacgagcga       720
     accgtgtccc gtctccgtga gcgactggtc gaacaggtcg ggccccaagc actcgaacag       780
     ccaggctggc tcatcggtgg ccccgaccgt atcagcgcac tgctcgcgga gtatcatgcg       840
     gctggagcgg actggatcaa cgtgacggtt cgaccaccgg tcgatttcga ggcgctccag       900
     gcgttcgtcg aacgcgtgat gccgcacttc gcgagctga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page