(data stored in ACNUC30630 zone)

EMBL: CP001275.PE425

CP001275.PE425       Location/Qualifiers
FT   CDS_pept        431933..433027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0436"
FT                   /product="beta-lactamase"
FT                   /note="identified by match to protein family HMM PF00144;
FT                   match to protein family HMM PF00768"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05129"
FT                   /db_xref="GOA:B9KY91"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY91"
FT                   /protein_id="ACM05129.1"
FT                   /translation="MASVLMLALLGTTTRAVAVVPEVSSRPAPSSAYQPAERPTLTARA
FT                   SFAVDITAGVELWAQEADRPLPPASTTKLMTALVVRRWLRPDESITIRSDDLVDPAVYA
FT                   NAGFQPGDRVTVTDLLAAMLIASAGDAALALARVAGERIDPEHDVPRTAFIDAMNQEAA
FT                   RLGLRHSWFATPDGRDVPGQTVSARDLAIIAAAVLSDPLLAELVATRTREIEIAGPQSR
FT                   RITVVNTNQFLTEPDALGVKTGTSVAAGQCLVAAVRRGNDIVVLVLLSSRDRYADARAL
FT                   LTYLDRQYRWFTLDGRSFAELARLAREGIVPALVPTVVVANETADQVRVIIDRQHSSAD
FT                   VVGTVRLRIGTSDLFIVPLLRVER"
     atggcctcgg tgctcatgct cgctcttctc gggacgacaa cgcgagcggt ggctgtcgtc        60
     ccggaggtgt ccagccgccc cgcgccgtca tcggcctacc agcctgccga gcgccccacg       120
     ctcactgccc gggcgagctt tgcggtcgat atcacggccg gggtggaact ctgggcgcaa       180
     gaagctgatc gccctctgcc gccagcgagt acgaccaaac tgatgactgc tttggtcgtc       240
     cggcgctggc tccggccgga cgagtcgatc acgattcggt ccgatgacct cgtcgatccg       300
     gccgtctatg ccaatgctgg cttccagcct ggtgatcgcg taacggtgac cgatctcctg       360
     gccgccatgc tgatcgcctc ggccggtgat gcggcactcg ccctcgctcg ggtcgctggg       420
     gagcggatcg atccggaaca tgacgtgccg cggactgcct tcatcgacgc gatgaaccaa       480
     gaagccgcgc gtctcggctt gcggcattcg tggttcgcaa cgccggatgg gcgtgacgtg       540
     cccggtcaga ccgtctcggc gcgcgatctc gcgatcatcg ccgcagcggt cttgagcgac       600
     ccgttgctcg ccgagctcgt tgcgacacgg acgcgcgaga tcgagatcgc cgggccacag       660
     agtcgccgga tcacggtcgt caacacgaac cagttcctca ccgagcccga tgcgctcgga       720
     gtcaagacag gcacctcagt ggctgcggga caatgcctgg tggccgcggt acgacgcggc       780
     aacgacatcg tggtactcgt gttgctgagc agtcgcgacc gttacgctga cgcgcgggca       840
     ctgctgacct atctcgaccg gcagtaccgg tggtttaccc tcgatggccg atcgttcgcg       900
     gaattagcca ggctggcgcg agagggaatc gttccggctc tcgtgccgac cgtcgtggtc       960
     gcgaacgaga cagctgacca ggtgcgggtc atcatcgatc ggcagcactc atcagccgat      1020
     gtcgtcggta cggtacgatt acggatcgga acgagcgacc tcttcatcgt gccgctcctg      1080
     cgtgtggagc ggtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page