(data stored in ACNUC30630 zone)

EMBL: CP001275.PE426

CP001275.PE426       Location/Qualifiers
FT   CDS_pept        433028..433876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0437"
FT                   /product="possible pseudouridine synthase"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04975"
FT                   /db_xref="GOA:B9KY92"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY92"
FT                   /protein_id="ACM04975.1"
FT                   /translation="MSVTMTEQRLQRVLAAHGVASRRKAEELILAGRVTVDGVVVRELG
FT                   RKVDPERQEICVDGKPLHSEPRRYIVLHKPVGYITTTADEYGRKTVLDLVQVPERVVPV
FT                   GRLDRDSSGLLLLTNDGDLIYRITHPRYELEKEYEVLVDGFPPPEVEEALRRGVPVDGR
FT                   PVRIRRLEAIRVEPQGTVYRVVIHEGRNRIIRRVFERVGYPVLRLQRVRVGPLRLGDLP
FT                   PGRWRDLTASEVAALRRAVGLPEFPEGAVGRERKARGGRGMPARRGDRRPSGVRKEHRR
FT                   R"
     gtgagcgtga cgatgaccga gcagcgactg cagcgtgttc ttgccgcgca cggtgtcgca        60
     tcgcggcgga aagccgaaga gctgattctg gcgggtcggg tgaccgtcga tggcgtcgtc       120
     gtgcgcgaac tcgggcgcaa ggtcgatcca gagcgccagg aaatctgtgt cgacggaaag       180
     ccgctccact cggagcctcg gcgatacatc gtgctgcaca aaccggtggg ttacatcacg       240
     acgactgccg atgaatacgg acgtaagacg gtgctcgatc tcgtccaggt tcctgagcgt       300
     gtcgtacccg ttggacgact ggatcgagat tcctcgggtc tcctcctcct caccaatgac       360
     ggcgatctga tctaccggat cacgcatccg cgctacgagc tggaaaagga gtacgaggtt       420
     ctcgtcgatg gctttcctcc acctgaagtc gaggaagcct tgcgtcgcgg cgtgccggtc       480
     gatggacgtc cggtacggat tcgacgatta gaggcgattc gggtcgagcc gcagggcacc       540
     gtgtatcgcg tcgtgataca cgagggacgc aaccgcatca tccgtcgtgt cttcgagcgt       600
     gtcggctatc cggtgcttcg cttgcagcgc gttcgcgtcg ggccgttacg actcggtgat       660
     cttccgcccg gacgatggcg cgacctcaca gccagcgagg tagcggcctt gcgccgagcg       720
     gtcggcttac cggagtttcc cgagggagcg gtgggaaggg aacggaaggc gcgtggtggc       780
     aggggcatgc cagctcgtcg tggcgatcga cggcccagcg gggtcaggaa agagcaccgt       840
     cggcgctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page