(data stored in ACNUC30630 zone)

EMBL: CP001275.PE445

CP001275.PE445       Location/Qualifiers
FT   CDS_pept        452020..452238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0456"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06091"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB1"
FT                   /protein_id="ACM06091.1"
FT                   /translation="MRGLAKPGSVAGSLQLHLRVSGRLDGRLFAARPLLVPRRRAASGT
FT                   TEGLGRYDCPLGEIMVGYEQGAHAGKR"
     gtgcgtggtc tcgcaaagcc aggatcagtt gctggttcgc ttcagctcca cttgcgggtg        60
     tctggtcggc tggatggtcg cctcttcgct gctcgcccgt tgctggtccc gcggagaaga       120
     gcagcgtcgg gcaccactga gggtttgggc cggtacgatt gcccgctcgg cgagatcatg       180
     gtagggtacg agcaaggtgc ccatgccggg aagcggtga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page