(data stored in ACNUC30630 zone)

EMBL: CP001275.PE447

CP001275.PE447       Location/Qualifiers
FT   CDS_pept        complement(452695..453408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0457"
FT                   /product="redox-sensing transcriptional repressor rex"
FT                   /note="identified by match to protein family HMM PF02629;
FT                   match to protein family HMM PF06971"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05751"
FT                   /db_xref="GOA:B9KYB3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB3"
FT                   /protein_id="ACM05751.1"
FT                   /translation="MRNGPVPDIVVRRLPLYLRTLRQLQREGHRTISSEELAQLLGVTA
FT                   AQIRRDLSYFGRFGKQGYGYAVAALIHELEVILHLDRLWNVALVGYGKLGQAIAHYGEF
FT                   EPNGFRITAIFAKSPEHIGQIVNGIVVLPETEIDRVVREQGIRIGIIAVPPDAAQEVAD
FT                   KLVAGGVRAILNYAPTVLHVPPGITVREIDPISALQSMTFYLHDRHDASGNGQDEQSFA
FT                   DIMERSPVGKRPAAH"
     gtgcgcaacg gaccagttcc ggacatcgtc gttcggcgct tgccgctcta cttgcggacg        60
     ctgcggcaac tccagcgaga gggacaccgc acgatctcct ccgaggaact ggcgcagttg       120
     ctcggcgtca ccgctgccca aatccgacgt gacctctcgt acttcggtcg cttcggcaag       180
     caaggctacg gctatgccgt ggccgcgctg attcacgagc tggaggttat ccttcacctc       240
     gatcgcctct ggaacgtagc gctcgtcggt tatggcaaac tcggccaagc catcgcccac       300
     tatggcgagt tcgagcccaa tggtttccgc atcactgcga tcttcgccaa gagccccgag       360
     cacatcggac agatcgtcaa cggtatcgtc gtcctaccgg agaccgagat cgatcgagtc       420
     gtccgcgagc aaggcatccg tatcggaatc atcgccgtac cgcccgacgc agcgcaagaa       480
     gttgccgaca aactcgtggc tggcggagtg cgcgcgattc tcaattacgc gccgaccgtc       540
     ctccacgtcc cgccaggaat cacggttcga gaaatcgatc ccatcagcgc gctccaaagc       600
     atgaccttct accttcatga tcgtcatgac gcgtcgggaa acgggcagga tgagcagtcg       660
     ttcgctgata tcatggaacg atcccccgta gggaaacgtc cggcagcaca ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page